KEGG   Bradyrhizobium japonicum USDA110: blr0315Help
Entry
blr0315           CDS       T00109                                 

Gene name
nosZ
Definition
nitrous-oxide reductase (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    blr0315 (nosZ)
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     blr0315 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
326883..328835
Genome map
AA seq 650 aa AA seqDB search
MSDSDNIKGVSRRTLLGTTAAAAGVGLAGGAVVTKDGAGFVSTADAQTKSAAPKAPPARP
AVQKTEVAPGELDEYYVFFSSGQSGEMRIIGLPSMRELMRVPVFNRCSATGWGQTNESLK
VLTEGMQPATREFLKNRGGTFMNGDLHHPHVSFTDGTYDGRYAFMNDKANSRVARVRLDV
MKCDKIIELPNQHTVHGLRLQKYPRTGYVFCNGEDGVPLPNDGKVLDNPKEYHSIFTALD
GDTMKVAWQVMVSGNLDNVDSDYQGKYCFSTCYNAEEGVTLAEMTANEQDWVVIFNLKRI
EEAVKKGDFKEMNGVPVIDGRKGSPYTRYVPVSNNPHGMNTAPDGIHIVAAGKLSPTVTV
MDVRLFDQLFDDKIKPRDVVVAEPELGLGPLHTAYDGKGNAYTTLFLDSQVVKWNIDLAK
RAFKGEKVDPIIQKLDVHYQPGHNHSSMGQTKEADGKWLISLNKFSKDRFLNVGPLKPEN
DQLIDISGDQMKLVHDGPSFAEPHDATIVHRSKINPISIWDRADPMFADAVKQAKADGIN
LEADSKIIRDGNKVRVYMTSTAPAFGLEQFQVKQGDQVTVYITNIDAVEDLTHGFCIVNY
GIQMEVAPMATASVSFSADKAGVYWYYCSWFCHAMHMEMKGRMFVEPKSV
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacagcgacaacatcaagggcgtcagccggcgaacgctgctggggaccacggcg
gccgctgcgggcgtgggacttgccggcggggcggtggtaacaaaggacggcgcgggcttc
gtctcgaccgccgacgcgcagaccaaatctgccgcacccaaggcaccgccggcgcgtccg
gccgtgcagaagaccgaagtcgcgccgggcgagctcgacgaatattacgtcttcttttcg
agtggccaatccggcgagatgcggatcatcgggctcccctcgatgcgcgaactgatgcgc
gttccggtcttcaaccgctgcagcgcgaccggctggggccagaccaacgaaagcctgaag
gttttgacagaagggatgcagccggcgacccgcgaattcctcaagaaccgtggcggcacg
ttcatgaacggcgacctccaccatccgcacgtctccttcacggacggcacctacgacggc
cgctacgccttcatgaacgacaaggccaacagccgcgtagcgcgggtgcggctcgacgtc
atgaagtgcgacaagattatcgaactgccgaatcagcacaccgtccacggccttcggctg
cagaagtatccacgaaccggatatgtgttctgcaacggggaagacggcgttccgctgccg
aacgacggcaaggttctcgacaacccgaaggaatatcactccatcttcacggcgctcgac
ggcgataccatgaaagtggcctggcaggtgatggttagcggcaatctcgacaacgtcgat
tccgactaccaaggcaaatactgcttctcgacctgttacaacgccgaagaaggcgtcact
ctggccgagatgaccgccaacgagcaggactgggtcgtcatcttcaacctcaagcggatc
gaggaggcagtgaagaagggtgatttcaaggaaatgaacggcgtgcccgtgatcgacggt
cgcaagggctcgccctacacgcgctacgttccggtgtcgaacaatccgcatggcatgaat
accgcgcccgacggcatccacatcgtcgcggcaggcaagctgtcgccgacggtgacggtg
atggacgttcggctgttcgaccaactgttcgacgacaagatcaaaccgcgcgacgtcgtg
gtcgccgagcccgaactcggcctcgggccgctgcatacggcctacgacggcaagggcaac
gcctacacgacgttgttcctcgacagccaggtcgtcaaatggaacatcgatctcgccaaa
cgagcctttaagggcgagaaggtcgatcccatcatccagaagctcgacgtccactatcag
cctggccacaatcactcctcgatgggtcagaccaaggaggccgacggaaaatggctgatc
tcgctgaacaagttttcgaaggaccgctttctcaacgtcggcccgctgaagccggagaac
gatcagttgatcgacatctcgggcgaccagatgaaactggtccatgacggtcctagcttc
gccgagccgcatgacgccaccatcgtgcaccgttccaagatcaacccgatctcgatctgg
gaccgcgccgatccgatgtttgccgatgcggtcaagcaagccaaggccgacgggatcaac
ctggaggcggattccaagatcatccgcgacggcaacaaggtgcgggtctatatgacctcg
accgctccggcgttcgggctcgagcagttccaggtcaagcagggcgatcaggtcaccgtc
tacatcaccaacatcgatgcggtcgaagacctgacgcacggcttctgcatcgtgaactac
ggtatccagatggaggtcgcgccgatggcgaccgcgtcggtgtcgttcagcgccgacaag
gcgggcgtctactggtactactgctcctggttctgccacgccatgcacatggagatgaag
ggccgcatgttcgtcgagccgaaatcggtctga

DBGET integrated database retrieval system