KEGG   Bradyrhizobium diazoefficiens USDA 110: blr0428Help
Entry
blr0428           CDS       T00109                                 

Gene name
proB
Definition
(RefSeq) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00330  Arginine and proline metabolism
bja00332  Carbapenem biosynthesis
bja01100  Metabolic pathways
bja01130  Biosynthesis of antibiotics
bja01230  Biosynthesis of amino acids
Module
bja_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    blr0428 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    blr0428 (proB)
Enzymes [BR:bja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     blr0428 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 1054409
NCBI-ProteinID: NP_767068
RhizoBase: blr0428
UniProt: Q89X86
Position
461604..462725
Genome map
AA seq 373 aa AA seqDB search
MASPELSQFRRIVVKVGSALLVDSDKGEVRTSWLAALADDMAKLHKEGRDVLVVSSGSIA
LGRSRLKLPRGPLKLEESQAAAAVGQIALARIWSEVLGAHGIDAGQILVTLQDTEERRRY
LNARSTIGKLLEWRAIPVINENDTVATTEIRYGDNDRLAARVATMASADLLVLLSDIDGL
YDAPPKNNPNAKLIPVVDSISSEIEAVAGDAESELSRGGMRTKVEAAKIATTGGTHMLIA
SGKIEHPLQAIANGGRCTWFLTPANPITSRKRWIAGTLEPKGTLTIDAGAVTALRAGASL
LPAGVIKVEGQFARGDAVIVRGPDTSEIGRGLIAYDADDAERIKGRSSPDVMTILGISGR
AEMIHRDDLVVGG
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggccagccccgaactcagtcaattccgccgcatcgtcgtcaaggtcggctccgcactg
ctggtcgattccgacaagggcgaggtgcggacgtcctggctcgccgcgcttgccgacgac
atggccaagctgcacaaggagggacgcgacgtcctcgtcgtctcctcgggctcgatcgcg
ctcggccgcagccggctcaagctgccgcgcggcccgctgaagctggaggagagccaggcc
gccgctgccgtcggccagatcgcgctggcgcggatctggtccgaggtgctcggcgcgcac
ggcatcgacgccgggcagattctcgtgacgctccaggataccgaggagcgccgccgctat
ctcaatgcgcgctccaccatcggcaagctcctggagtggcgcgccatccccgtgatcaac
gagaacgacacggtcgccaccaccgagatccgctacggggacaacgaccgcctcgccgcg
cgcgtcgcgaccatggcgagcgccgatctcctggtgctgctctccgatatcgacgggctc
tacgatgcccccccgaagaacaacccgaacgcaaagctcattcccgtcgtcgacagcatc
tcctcggagatcgaggctgtcgcaggcgacgccgagtccgagctctcgcgcggcggcatg
cgcacgaaggtcgaggcggccaagatcgccacgaccggcggcacgcatatgctgatcgcc
tccggcaagatcgagcatccgctgcaggcaatcgccaatggcggccgctgcacctggttc
ctgacaccggccaatcccatcacctcgcgcaagcgctggatcgcgggcacgctggagccg
aagggcacgctgacgatcgacgccggcgcggtgacggcgctgcgggccggcgccagcctg
ctgccggccggcgtgatcaaggtcgagggccagttcgcccgcggcgatgccgtgatcgtg
cgcggccccgatacgagcgagatcggccgcggcctgatcgcctatgacgccgacgacgcc
gaacgcatcaagggccgctcctcccctgatgtgatgaccatcctcggcatcagcggccgc
gcggagatgatccaccgtgacgatctggtggtgggcgggtaa

DBGET integrated database retrieval system