KEGG   Bradyrhizobium diazoefficiens USDA 110: blr0513Help
Entry
blr0513           CDS       T00109                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    blr0513 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    blr0513 (sdhD)
   00650 Butanoate metabolism
    blr0513 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    blr0513 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
550050..550454
Genome map
AA seq 134 aa AA seqDB search
MSATDTPKRSMRTPLGRVRNLGAAHSGTSDFWRQRITGVAMVLMMIPVIVIIVMLFGRNQ
AFVAQTIGSLPIAIIMLLFIFASAWHMKIGMQVVIEDYVHNEKLKLTAIMLNNFFSIAVA
LASTYAILKLSSGV
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaaccgatacgccgaagcgcagcatgcgcaccccgctcggccgcgtccgcaat
ctcggcgcggcgcattcgggcacgtcggacttctggcgccagcgcatcaccggcgtcgcg
atggtgctgatgatgatcccggtgatcgtgatcatcgtgatgctgttcggccgcaaccag
gccttcgtagcgcagaccatcggctcgctgccgatcgccatcatcatgctgctcttcatc
ttcgccagcgcctggcacatgaagatcggcatgcaggtggtgatcgaggactacgtccat
aacgagaagctgaagctcacggcgatcatgctcaacaacttcttctcgatcgccgtggca
ctcgcctcgacctacgcgatcctgaaactttcatccggagtgtaa

DBGET integrated database retrieval system