KEGG   Bradyrhizobium japonicum USDA110: blr0534Help
Entry
blr0534           CDS       T00109                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bja00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bja00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bja02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
574307..575890
Genome map
AA seq 527 aa AA seqDB search
MTAPDAPKTTSESTMNIKFSRRHFLATSTGALGAIAMPYLSRAADRPAVTHGVQSGDVTV
DGGVVWARADRPSQMLVEVATTESFKDARALPPIAALPESDFTAKMLIENLPGGQDIFYR
VRFRDLSHGAIEGEPVVGRFRTAPADRRDVSFVWGGDVAGQGWGINPDDGGMFTFSAMRK
HRPDFFLHSGDTIYADGPIESEVKLADGKTWKNVTIPEKAKVAETLDEYRAAHKYNLTDA
NLRAVNAEVPIFVQWDDHEVTNNWSLSKELPATYKVRDIALLAARAGRAFHEMYPMRESI
NEPGRVYRQISYGPHLDVFVLDERSYRGPNGANLETAYGPASYFLGPDQIAWLKRGLLNS
RATWKVIASDMPLSLVVSDTPKGGSEAIAQGDGPVRGREFEIADILRFIKTAPISNTVWL
TADVHYAAAHYYDPNKAQFQDFEPFWEFVSGPLHAGTFGPNALDNTFGPEVRFVKAPGKD
SQNLPPSAGMQFFGHVKIDGASGQMTVTLRDRADVALWSTTLDPKLA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgccagatgcgcctaagacaaccagcgaatccaccatgaacatcaaattctcc
cgccgccatttcctcgccaccagcaccggtgcgcttggcgcaatcgcaatgccctatctg
tcgcgcgcggccgaccggccggcggtcacccatggcgtgcagtcgggcgacgtcaccgtc
gacggcggcgtggtctgggcgcgcgccgatcgtccatcgcagatgctggtcgaggtggcg
acgacggagtccttcaaggacgcgcgcgcgctgccaccgatcgcggcgctgcccgaaagc
gatttcaccgcgaagatgctgatcgaaaatctgccgggcgggcaggacatcttctatcgc
gtccgcttccgcgatctctcgcacggcgcgatcgagggcgagccggtggtcggccgcttc
cgcaccgcgccggccgaccgccgcgacgtcagcttcgtctggggcggcgacgtcgcaggt
caaggctggggcatcaatcccgatgacggcggcatgttcaccttctcggcgatgcgcaag
catcgtccggatttcttcctgcactcgggcgacacgatctatgccgacggcccgatcgaa
tccgaggtgaagctcgccgacggcaagacctggaagaacgtcaccattcccgagaaggcc
aaggtcgccgagacgctggacgagtaccgcgccgcgcacaaatacaatctcaccgacgcg
aacctccgcgccgtcaatgccgaagtgccaatcttcgtgcaatgggatgaccacgaggtg
accaacaactggtcgctgtcaaaggagctcccggcgacctacaaggtgcgcgacatcgcg
ctgctcgcagcgcgcgcgggccgcgccttccacgagatgtatccgatgcgcgagagcatc
aatgagccgggccgcgtctatcggcagatctcctacggcccgcatctcgacgtgttcgtg
ctcgacgagcgcagctatcgcggccccaacggcgccaatctcgaaaccgcttacggcccc
gccagctatttcctcggcccggaccagatcgcctggctcaagcgcggcctgctcaactcg
cgcgcgacctggaaggtgatcgcctccgacatgccgctcagcctcgtcgtctcggacacg
ccgaagggcggatcggaagcgatcgctcagggcgacggcccggtgcgtggccgcgagttc
gagatcgccgacatcctgcgcttcatcaagacggcgccgatcagcaacacggtgtggctg
accgcggacgtgcattacgccgccgcgcattactacgacccgaacaaggcgcaattccag
gatttcgagccgttctgggaattcgtctccggcccgctgcacgcaggcaccttcggtccg
aacgcgctcgacaacacgtttgggccggaggtgcgcttcgtcaaggcgccgggcaaggac
agccagaacctgccgccgtcggccggcatgcagttcttcggtcacgtcaagatcgacggc
gcctccggccagatgacggtgaccctgcgcgaccgcgccgacgtcgcgctgtggtcgacg
acgctggatccgaagctcgcttga

DBGET integrated database retrieval system