KEGG   Bradyrhizobium diazoefficiens USDA 110: blr0573Help
Entry
blr0573           CDS       T00109                                 

Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00010  Glycolysis / Gluconeogenesis
bja00620  Pyruvate metabolism
bja00640  Propanoate metabolism
bja00680  Methane metabolism
bja01100  Metabolic pathways
bja01110  Biosynthesis of secondary metabolites
bja01120  Microbial metabolism in diverse environments
bja01130  Biosynthesis of antibiotics
bja01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    blr0573
   00620 Pyruvate metabolism
    blr0573
   00640 Propanoate metabolism
    blr0573
  Energy metabolism
   00680 Methane metabolism
    blr0573
Enzymes [BR:bja01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     blr0573
Lipid biosynthesis proteins [BR:bja01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   blr0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 1049589
NCBI-ProteinID: NP_767213
RhizoBase: blr0573
UniProt: Q89WV5
Position
614137..616095
Genome map
AA seq 652 aa AA seqDB search
MEGNMSEKIYDVPAEWAKRAWVDQAKYKEMYARSISDPNGFWAEQAKRIDWMKAPTKIEN
VSFAPGNVSIKWFEDGVLNVAHNCIDRHLHKRANQTAIIWEGDDPSQSRHITYKELHDEV
CRMANILRTRNVKKGDRVTIYLPMIPEAAYAMLACARIGAIHSVVFAGFSPDSLAQRIND
CQSKVIITADEGLRGGKKVPLKANVDAALAKADGVDWVVVVKRTGGKIDMNPTRDLWYHE
AAAMVTTECPVEHMHAEDPLFILYTSGSTGQPKGVLHTSAGYLVYAAMTHQYVFDYHDGD
IYWCTADVGWVTGHSYILYGPLANGATTLMFEGVPNYPDNSRFWNVIDKHKVNTFYTAPT
AIRALMQGGDEPVKKTSRASLRLLGSVGEPINPEAWEWYHRVVGEDRCPIVDTWWQTETG
GILITPLPGATKLKPGSATQPFFGVVPEIVDADGKVLEGETTGNLCLTRAWPGMMRTVYG
DHARFEQTYFSTYKGKYFTGDGCRRDADGYYWITGRVDDVINVSGHRMGTAEVESALVAH
EKVSEAAVVGFPHDIKGQGIYAYVTLMAGVQPTEDLRKELVTWVRKEIGPIASPDQIQFA
PGLPKTRSGKIMRRILRKIAEDEPGSLGDTSTLADPAVVDDLVKNRQNKKSA
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
gtggagggaaatatgtccgagaagatttacgacgtgccggcggaatgggcaaagcgcgcc
tgggtcgaccaagccaagtacaaggaaatgtacgcccgctcgatctcggacccgaacggt
ttctgggccgaacaggccaagcgcatcgactggatgaaggcgccgacgaaaatcgagaac
gtctccttcgcgccgggcaacgtctcgatcaaatggttcgaggacggcgtcctcaacgtc
gcccataactgcatcgaccgtcatctgcacaagcgcgccaaccagaccgcaatcatctgg
gaaggtgacgatccctcgcagtcccgccacatcacctacaaggagctccacgacgaggtc
tgccggatggccaacatcctgcgtacccgcaacgtcaagaagggcgaccgcgtcaccatc
tacctgccgatgattccggaagcggcctacgcgatgctggcgtgcgcgcggatcggcgcg
atccactccgtggtgttcgcgggcttctcgcccgacagcctcgcccaacgcatcaacgac
tgccagtccaaggtgatcatcaccgccgacgaaggcctgcgcggcggcaagaaggtgccg
ctgaaggccaatgtcgacgcggcgctcgccaaggccgacggcgtcgactgggtcgtcgtg
gtcaagcgcaccggcggcaagatcgacatgaacccgacccgcgacctctggtatcacgag
gcggcggcgatggtgacgacggaatgcccggtcgagcatatgcacgccgaggatccgctg
ttcatcctctatacctcaggctcgaccggccagcccaagggcgtgctgcacacctccgcc
ggctatctcgtctatgccgcgatgacgcatcaatacgtcttcgactatcacgacggcgac
atctactggtgcaccgccgacgtcggctgggtcacgggccacagctacattctctacggg
ccgctcgccaacggcgcgaccacgctgatgttcgagggcgtgccgaattatccggacaat
tcccgcttctggaacgtcatcgacaagcacaaggtcaataccttctacaccgcgccgacc
gcgatccgcgcgctgatgcagggtggcgacgagccggtgaagaagacctcgcgcgcctcg
ctgcgcctgctcggctcggtcggcgagcccatcaatccggaagcctgggagtggtatcac
cgcgtcgtcggcgaggaccgctgcccgatcgtcgatacctggtggcagaccgagaccggc
ggcatcctgatcacgccgctgccgggcgccactaagctcaagccgggctcggcgacgcag
cccttcttcggcgtggtgccggagatcgtcgatgccgacggcaaggttctggaaggcgag
accaccggcaatctctgtctcacccgggcatggccgggcatgatgcgcacggtctatggc
gatcacgcgcggttcgagcagacctatttctcgacctacaagggcaagtattttacgggc
gacggctgccggcgcgacgccgacggctattactggatcaccggccgcgtcgacgacgtc
atcaacgtctccggccaccgcatgggcaccgcggaggtcgagagcgcgctggttgcgcat
gagaaggtgtcggaagctgccgtcgtcggcttcccgcacgacatcaagggccagggcatc
tacgcctatgtcaccctgatggccggcgtccagccgaccgaggatctgcgcaaggagctc
gtgacctgggtgcgcaaggagatcggcccgatcgcctcgcccgaccagatccagttcgcg
ccgggcctgcccaagacccgctccggcaagatcatgcgccgcatcctgcgcaagatcgcc
gaggacgagccgggcagcctgggcgacacctcgaccctggccgatcccgccgtggtcgac
gacctcgtcaagaaccggcagaacaagaagtcggcgtaa

DBGET integrated database retrieval system