KEGG   Bradyrhizobium diazoefficiens USDA 110: blr0638Help
Entry
blr0638           CDS       T00109                                 

Definition
(RefSeq) Maf-like protein
  KO
K06287  
septum formation protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
685996..686604
Genome map
AA seq 202 aa AA seqDB search
MGLWRGKSPLILASQSSARKMLLANAGLEFIAITADIDERGIQAASKLSSPRDIGLLLAR
EKAKAVSANHPGSHVIGADQTLALGERLFNKPAGRAQAMAQLRDLAGNYHELNSAVAVAH
DGKIVFEDVSVARMTMRQMSEAELSAYLDAAGDAVTTSVGAYQLEGLGIHLFERIEGDHF
TILGLPLLPLLAFLRSEQLIAV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgtggcgcggcaaatctccgttgatcctggcctcgcaaagcagcgcgcgaaag
atgctgctggcgaatgccgggctggagttcatagcgatcacggccgatatcgacgagcgc
ggcatccaggccgcgtcgaagctttcgagtcctcgcgacatcggtctcttgctggcgcgc
gaaaaggccaaagccgtgtcggccaatcatccgggaagccatgtcatcggcgccgaccag
accctggcccttggcgagcgtctcttcaacaagcccgccggccgcgcgcaggcgatggcg
caattgcgtgatctcgccggcaactaccatgagctgaattcggcggtggccgtggcacat
gacggcaagattgtcttcgaggacgtctcggtggcccgcatgaccatgcgacagatgagc
gaggcggagctttcggcctatcttgacgcggccggggacgccgtgacgaccagcgtcggc
gcctatcagctcgagggcctcggcattcacctgttcgagcgcatcgagggcgaccatttc
accattttgggtttgccgctgctgccgctgcttgcgttcctgcggagcgaacagctaatt
gcagtttga

DBGET integrated database retrieval system