KEGG   Bradyrhizobium diazoefficiens USDA 110: blr0745Help
Entry
blr0745           CDS       T00109                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    blr0745 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    blr0745 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    blr0745 (trpB)
Enzymes [BR:bja01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     blr0745 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
792873..794090
Genome map
AA seq 405 aa AA seqDB search
MNIAKPNSYRSGPDERGHFGIFGGRFVAETLMPLILDLEKAYTAAKADPAFQAEMNGYLK
NYVGRPSPLYFAERLTEHLGGAKIYLKREELNHTGSHKVNNVLGQIMLARRMGKKRIIAE
TGAGQHGVATATLCARFGLECVVYMGAVDVERQQPNVIRMEMLGAKVVPVQSGTRTLKDA
MNEALRDWVTNVHNTFYCIGTVAGPHPYPTLVRDFQSIIGNETKAQMQEVEGRLPDSLVA
CIGGGSNAMGLFHPFLDDPSVEIFGVEAAGHGLTQLHAASIAGGRPGVLHGNRTYLLMDA
DGQIQDAHSISAGLDYPGIGPEHSWLHEIGRVNYLSATDDEALAAFQLLSKLEGIIPALE
PAHAIAKVMELAPKRAKDHLMVVNLSGRGDKDVPQVGDILRGKSK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgccaaaccaaactcctaccgcagcgggcccgacgagcgcggtcatttcggc
atcttcggcggacgcttcgtcgccgaaacgctgatgccgctgatcctcgatctggagaag
gcctacaccgcggccaaggccgatccggccttccaggccgagatgaacggctatctcaag
aactatgtcggccggccctcgccgctctatttcgccgagcgtctcaccgagcatctcggc
ggcgccaagatctacctcaagcgcgaagagctcaaccacaccggctcgcacaaggtgaac
aacgtgctcggccagatcatgctggcgcggcgcatgggcaagaagcgcatcattgccgag
accggcgccggccagcacggcgtcgccaccgcgacgctgtgcgcgcgcttcggcctcgaa
tgcgtggtctatatgggcgccgtcgacgtcgagcggcagcagcccaacgtgatccgcatg
gagatgctgggcgcaaaggtggtcccggtacagtcgggcacgcgcacgctgaaggacgcc
atgaacgaggcgctgcgcgactgggtcaccaacgtgcacaacacgttctactgcatcggc
acggtggcgggcccgcatccctatccgacgctggtgcgcgacttccagtcgatcatcggc
aacgagaccaaggcgcagatgcaggaggtcgagggccgcctgccggattcgctggtcgcc
tgcatcggcggcggctcgaatgcgatgggcctgttccaccccttcctcgacgatccctcc
gtcgaaattttcggcgtcgaagctgcaggccacgggctcacgcagctgcatgcggcctcg
atcgcgggcggccgtcccggcgtgctgcacggcaaccgcacttatctcctgatggacgcg
gacggccagatccaggacgctcattcgatctcggccggcctcgactatcccggcatcggc
cccgagcattcctggctgcacgagatcggccgcgtgaattatctctccgcgaccgacgac
gaggcgctcgctgcgttccagctgctgtcaaagctggaaggcatcatcccggcgctcgag
cccgcgcatgccatcgccaaggtgatggagctcgcgccgaagcgcgcaaaagatcacctg
atggtcgtcaatctctccggccgcggcgacaaggacgtcccgcaggtcggcgacatcctg
aggggcaagagcaagtga

DBGET integrated database retrieval system