KEGG   Bradyrhizobium diazoefficiens USDA 110: blr0746Help
Entry
blr0746           CDS       T00109                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    blr0746 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    blr0746 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    blr0746 (trpA)
Enzymes [BR:bja01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     blr0746 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
794087..794923
Genome map
AA seq 278 aa AA seqDB search
MTTRIDIRFAELAKQGRSAFVTFLMAGDPDPATSLEIIKALPKSGADVIEIGMPFTDPMA
DGPSIQAAGLRALKAGMTLKKTLELVRGFRKDDNATPIVLMGYYNPIYIYGVDKFLVDAK
SAGVDGLIIVDLPPEEDDELCLPAMKAGLNFIRLATPTTDDKRLPAVLANTSGFVYYVSI
TGITGAAAADSSAVSEAVARIKRHTKLPVCVGFGIRTPETARAIASHANGAVVGTALVDA
LKNSLDADGRATAKTVNAVAELTASLAQGVKGAQQAAE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgcgtatcgacatccgttttgccgagcttgcgaagcagggccgctcggccttc
gtgaccttcctgatggccggcgatccggatcccgccacctcgctcgagatcatcaaggcg
ctgccgaagtccggcgccgacgtgatcgagatcggcatgcccttcaccgatccgatggcc
gacggtccgtcgatccaggcggcgggcctgcgcgcgctcaaggccggcatgacgctgaag
aagacgctcgagctcgtgcgcggcttccgcaaggacgacaatgcgacgccgatcgtgctg
atgggctattacaacccgatctacatctacggcgtcgacaagttccttgtcgatgccaag
agcgccggcgtcgacggcctcatcatcgtcgatctgccgccggaggaggacgacgagctc
tgcctgcccgcgatgaaggccggcctgaacttcattcgcctggcgacgccgacgaccgac
gacaagcgcctgccggccgtgctcgccaacacctcgggcttcgtctactacgtctcgatc
accggcatcaccggtgctgcggcggcggattcctcggcggtgagcgaagcggttgcccgc
atcaagcgtcacaccaagctgccggtctgcgtcggcttcggcatccgcacgccggagacc
gcgcgcgccatcgcctcgcatgcgaatggcgcggtggtcggcaccgcgctggtcgatgcg
ctcaagaacagcctcgatgcagacggccgggccaccgccaaaaccgttaacgccgtcgcc
gaactgacggcatccctggcccaaggcgtcaaaggcgcacaacaggcggcggaatag

DBGET integrated database retrieval system