KEGG   Bradyrhizobium japonicum USDA110: blr0762Help
Entry
blr0762           CDS       T00109                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bja03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
816280..817161
Genome map
AA seq 293 aa AA seqDB search
MPELPEVETVRRGLQPVMEGAKIVVAEARRPDLRFPFQPDFVARLQGQVVTGLGRRAKYL
MADLASGDVLLMHLGMSGSFRVIKPDNDAAPGEFHYPRGKDTTHDHVLFRMSSGADIVFN
DPRRFGYMKVIARNALEDEPLLRGLGPEPLGNEFDAAMLARSCEGKATSLKAALLDQRVV
AGLGNIYVCEALHRSHLSPRRIAATLATRKGEPTDHAKRLVGAIHTVLNDAIKAGGSSLR
DHRQTTGELGYFQHSFKVYDREGETCKTPACGGTIKRFTQNGRSTFWCPKCQK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattgcccgaagtcgagaccgtccgccgcggccttcagcccgtcatggagggt
gcgaaaatcgtcgtcgcggaggcccgcaggccggacttgcgctttccgttccagccggac
ttcgtggcccggctccaggggcaggtcgtcacggggctcggccgccgcgcaaaatatctc
atggccgatctggcctccggcgacgtgctcttgatgcatctgggcatgtcgggctcgttt
cgcgtcatcaagccggacaatgatgccgcacctggggagtttcactatccacggggtaag
gacaccacccatgaccacgtgctgtttcggatgtcctccggcgccgacatcgtcttcaac
gatccgcgccgcttcggttacatgaaagtgatcgcgcgcaacgcgctcgaggacgagccg
ctgctccgcggcctcggccccgagccgctcggcaacgaattcgatgccgcgatgctggcg
cgatcttgcgaaggcaaggccaccagcctgaaggccgcgctgctcgaccagcgtgtggtg
gcagggctcggcaacatctatgtctgcgaagcgctgcatcgctcgcacctgtcgccgcgc
cggatcgctgcgacgttggcgaccaggaagggcgagccaacggatcacgcgaagagattg
gtcggtgcgatccacaccgtgctgaacgacgccatcaaggccggcggctcgtcactgcgc
gaccatcgccagaccacaggtgagctcggctacttccagcattcgttcaaggtctatgac
cgcgaaggcgagacctgcaagacgcctgcctgcggcggcacgatcaagcgcttcacccag
aacggccgttcgaccttctggtgtccgaaatgtcagaagtga

DBGET integrated database retrieval system