KEGG   Bradyrhizobium diazoefficiens USDA 110: blr0852Help
Entry
blr0852           CDS       T00109                                 

Gene name
uppS
Definition
(RefSeq) undecaprenyl pyrophosphate synthase
  KO
K00806  
undecaprenyl diphosphate synthase [EC:2.5.1.31]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Terpenoid backbone biosynthesis
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    blr0852 (uppS)
Enzymes [BR:bja01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.31  ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     blr0852 (uppS)
Prenyltransferases [BR:bja01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   blr0852 (uppS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
915141..915881
Genome map
AA seq 246 aa AA seqDB search
MQSDMTSRSEKLHVGIIMDGNGRWATRRGLSRLRGHEAGVETIRRIVEAAPKQGIGTLTL
YAFSTDNWRRPKAEVAALMTLLRFYLANEVQSLVKNGVRLTVIGRRDRLPDGIANAIARA
EAATAHGSTLHLRIAVDYSARDAILNAAAKAAALTSLTREAFSQLVTGEAGLRDVDLIIR
TSGEKRLSDFLLWEGAYAELHFTERMWPEFDAGDLAEALAAFHGRERRFGGLQAIMPEEV
PSLSRV
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtgacatgacctctcgcagcgagaagcttcacgtcggcatcatcatggacggc
aacggcagatgggcgacgcggcgcggcctgtcgcggctgcgcggccacgaggccggcgtc
gagacgatccgccgcatcgtcgaggcggcgcccaagcagggcatcggcacgctgacgctc
tatgcgttctcgaccgacaattggcgaaggccgaaggccgaggtcgcagcgctgatgacc
ctgctgcgcttctatctcgccaacgaggtgcagagcctggtgaagaacggggtgcgtctc
accgtgatcggccgccgcgaccggctgcctgacggcatcgcgaatgcgatcgcgcgggcc
gaagcggccaccgcccacggcagcacgcttcacctgcgcatcgccgtcgattattccgcg
cgcgatgccatcctcaacgcggcggcgaaggcggcggcgctgaccagcctcacccgcgaa
gcgttctcgcagctcgtcaccggcgaggccggtttgcgcgacgtcgatctcatcatccgc
acctcgggcgagaagcggctgtcggacttcctgctgtgggaaggcgcctatgccgagctg
cacttcaccgagcggatgtggccggaattcgatgcgggcgatctcgccgaggcgctcgcc
gcgttccacggccgtgagcggcgcttcggcggcctccaggcgatcatgcccgaggaggtg
ccgtcactctcgcgggtatga

DBGET integrated database retrieval system