KEGG   Bradyrhizobium diazoefficiens USDA 110: blr1160Help
Entry
blr1160           CDS       T00109                                 

Gene name
fadB
Definition
enoyl-CoA hydratase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    blr1160 (fadB)
   01212 Fatty acid metabolism
    blr1160 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    blr1160 (fadB)
   00650 Butanoate metabolism
    blr1160 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    blr1160 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    blr1160 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    blr1160 (fadB)
   00310 Lysine degradation
    blr1160 (fadB)
   00380 Tryptophan metabolism
    blr1160 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    blr1160 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    blr1160 (fadB)
   00281 Geraniol degradation
    blr1160 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    blr1160 (fadB)
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     blr1160 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     blr1160 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     blr1160 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1278239..1280452
Genome map
AA seq 737 aa AA seqDB search
MAYKNFKVETDADGIALVTWDIPGRSMNVLDETSTSELDAIVKATTADAAVKGVVITSAK
EAFCAGADLSMLEGMNQAYAKVFREQGETAANQMLFEQSRRFSQVLRSIETSGKPWAAAI
NGLALGGGFEITLCCHYRVAAENPKTRLGLPEVKVGLFPGAGGTQRVPRLVPPQDAMTIL
LKGDPVTVEKAKALNLIHAIVPAADLIKAAKDWIKGGGKAVAPWDEKGFKLPGGPVFSKA
GMMMFPAGNAIYRRETYDNYPAARAIMSCVYEGLQLPIDAALRVESRYFTSVLRSKEAAA
MIRSLFLSMQELNKGARRPKDVPATKVKKIAVIGAGFMGASVGYVSARAGLDVVLIDRDQ
DSADKGKAHAQKVIEEQIKKGRAKPNDAEALLARITPTADYAALKDVDLVLEAVFEDRKV
KAETFAKAQEYLKPDVVFASNTSTLPITSLAEAFKDQGKFVGIHFFSPVEKMMLVEIILG
KNTGDVALATALDYVRQIGKTPIVVNDSRGFFANRCVGRYVAEGNEMFLEGVPPAMIENC
AKMAGMPVGPLSLSDEVALDLGLKIMKATEADLGPNAINPDQKKLMVEMVEKQGRLGRKN
SKGFYDYPEKGKGQKSLWPGLSALQPKQLDPDTLDVEELKQRFLVVQAVEAARTVEDHVI
TDPREADVGSILGFGFAPFTGGTLSYIDFMGTKKFVELCHKLEAKYGSRFTPPKLLEEMA
AKGETFYGRFAPKKAAA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggcttacaagaatttcaaggttgaaaccgacgccgacggcatcgcgctcgtcacctgg
gacatcccgggccgttcgatgaacgtgctcgacgaaacctcgaccagcgagctcgacgcg
atcgtcaaggcgaccaccgccgacgccgcggtgaagggcgtcgtcatcacctcggccaag
gaggcgttctgcgccggcgccgatctgtcgatgctcgagggcatgaaccaggcctacgcc
aaggtcttcagggagcagggcgagaccgccgcgaaccagatgctgttcgagcagagccgg
cgcttctcgcaggtgctgcgctcgatcgagacctccggcaagccgtgggcggccgcgatc
aacggcctcgcgctcggcggcggtttcgagatcacgctgtgctgccactatcgtgtggca
gcggaaaatcccaagacgcgcctcggcctgcccgaggtcaaggtcggcctgttccccggc
gccggaggcacgcagcgcgtgccgcgcctggtgccgccgcaggatgcgatgaccattctg
ctcaagggcgatccggtcacggtcgagaaggccaaggcactcaatctgatccacgccatc
gttccggccgctgaccttatcaaggccgcgaaagactggatcaagggcggcggcaaggcc
gtcgcgccctgggacgagaagggcttcaagctgcccggcggtccggtgttctccaaggcc
ggcatgatgatgttcccggccggcaacgcgatctatcgccgcgagacctacgacaactat
cccgccgcgcgcgcgatcatgagctgcgtctatgaaggcctgcagctgccgatcgacgcc
gcgctgcgggtcgagtcgcgctacttcacctcggtgctgcgctccaaggaagcggccgcg
atgatccgcagcctgttcctgtcgatgcaggagctcaacaagggcgcgcgccgtccgaag
gacgtgcccgcaaccaaggtgaagaagatcgccgtgatcggcgccggcttcatgggcgcg
agcgtcggctacgtctccgcgcgtgccggcctcgacgtcgtcctgatcgatcgcgaccag
gacagcgccgacaagggcaaggcgcatgcgcagaaggtgatcgaggagcagatcaagaag
ggccgcgccaagcccaatgatgccgaagcgctgctcgcgcgcatcacgccgacggccgac
tatgcagctctgaaggacgtcgacctcgtcctcgaggccgtgttcgaggaccgcaaggtc
aaggcggagacgtttgccaaggcgcaggaatatctgaagccggacgtagtcttcgcgtcg
aacacctcgacgctgccgatcacctcgctcgcggaagccttcaaggaccagggcaagttc
gtcggcatccatttcttctcgccggtcgagaagatgatgctggtcgagatcatcctcggc
aagaacactggcgatgtcgcgctcgcgaccgcgctcgactatgtccggcagatcggcaag
acgccgatcgtggtcaacgacagccgtggcttcttcgccaaccgttgcgtcggccgctac
gtcgccgaaggcaacgagatgttcctcgaaggcgtgccgccggcgatgatcgagaactgc
gccaagatggccggcatgccggtcggcccgctctcgctgtcggacgaagtggcgctcgac
ctcggcctcaagatcatgaaggcgaccgaagccgatctcggtccgaacgccatcaacccc
gatcagaagaagctgatggtggagatggtcgagaagcagggccgactcggccgcaagaac
agcaagggcttttacgactatcccgagaagggcaagggtcagaagagcctgtggccgggc
ctctcggcgctccagccgaagcagctcgaccccgacacgctcgacgtcgaggagctgaag
cagcgcttcctggtggtgcaggcggtggaagccgcgcgcacggtggaggaccacgtcatc
accgatccgcgcgaagcggatgtcggctcgatcctcggcttcggcttcgcgccgttcacc
ggcggcacgctgtcctacatcgacttcatgggcacgaagaagttcgtcgagctctgccac
aagctggaagcgaaatacggctcgcgcttcacgccgccgaagcttcttgaggagatggcg
gcgaagggcgaaaccttctacggccgcttcgcgccgaagaaggcggcggcctga

DBGET integrated database retrieval system