KEGG   Bradyrhizobium diazoefficiens USDA 110: blr1181Help
Entry
blr1181           CDS       T00109                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    blr1181 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    blr1181 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    blr1181 (thrC)
Enzymes [BR:bja01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     blr1181 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1298518..1299948
Genome map
AA seq 476 aa AA seqDB search
MEGSLTRYISTRGEAPELGFCDVMLTGLARDGGLYVPATWPQLSADTIAGFFGRPYWEVA
VDVIRPFAGGEITDAELGRMANEAYATFRHPAVVPLRQMSPHQFVLELFHGPTLAFKDVA
MQLISRLMDHVLAKRDQRTTIVVATSGDTGGAAVEAFAGLENVDLIVLFPHGRISEVQRR
MMTTTGAANVHALAIEGTFDDCQALVKGMFNNHRFRDATSLSGVNSINWARIVAQVVYYF
TSAVAAGAPARAVDFVVPTGNFGDIFAGYVAKRMGLPVRTLRIAANVNDILARTLKTGIY
EVREVHATASPSMDIQISSNFERLLFEAGRRDAAGVRRLMDSLKQSGRFVLPDATLAAIR
EEFDAGRADETETAAAIRAAWREAGELVDPHTAVALAVADRDTTDTTVPSIVLSTAHPAK
FPDAVEAACGQRPQLPAWLDGLMTKSEHMKVMKNDQAEVERFVLSVSRAAKQGVAG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
ttggagggcagtttgactcgttatatctcgacccggggcgaggcccccgaactcggcttc
tgcgacgtgatgctgaccgggcttgcccgcgacggtggcctgtatgtgccggcgacatgg
ccgcagctctcggctgacacgatcgccggcttcttcggccgcccgtattgggaggtcgcc
gtcgacgtgatccgtcccttcgccggaggcgagatcacggacgctgagctcggccggatg
gcgaacgaggcctacgccaccttccgccatcccgcggtggtgccgctgcgccagatgtcg
ccgcaccagttcgtgctggagctgttccacggcccgacgctcgccttcaaggacgtggcg
atgcagctcatctcgcggctgatggaccatgtgctcgccaagcgcgaccagcgcaccacc
atcgtggtcgcaacctccggcgacaccggcggcgctgcggtcgaagccttcgcggggctg
gagaacgtcgatctcatcgtactgttcccgcacggccgcatctccgaggtgcagcggcgg
atgatgacgacgacgggcgcggccaacgtgcatgcgctcgccatcgaaggcacgttcgac
gactgccaggccctcgtgaagggaatgttcaacaaccatcgcttccgcgatgcgacctcg
ctgtccggcgtcaattccatcaactgggcgcgtatcgttgcccaggtggtctattacttc
acctccgccgttgccgccggcgcgccggcgcgcgcggtggacttcgtcgtgccgaccggc
aatttcggcgacatctttgccggctacgtcgccaagcgcatgggtctgccggtgcggacc
ctgcgcatcgccgccaacgtcaacgacatcctggcgcggacgctgaagaccggcatctac
gaggtgcgcgaggtgcacgccacggcgtcgccgtcgatggacatccagatctcctcgaac
ttcgagcggctgctgttcgaagccggccggcgcgatgcggccggtgtgcgccgtctcatg
gattcgctgaagcagtccgggcgcttcgtgctgcccgatgcgacgctcgccgcgatccgc
gaggagttcgacgccgggcgcgccgacgagaccgaaaccgcggccgcgatccgcgccgcc
tggcgtgaggcgggcgagctggtcgatccccatactgcggtcgcgctcgcggtcgccgat
cgcgacaccaccgacaccacggtgcccagcatcgtgctctccaccgcgcatccggccaaa
ttccccgacgcggtcgaagcggcctgcggccagcggccgcaactgccggcctggctcgac
ggcctcatgaccaaatccgaacacatgaaggtgatgaagaacgatcaggccgaggtcgag
cggttcgtgctgtcggtcagccgtgccgcaaaacagggagttgccggatga

DBGET integrated database retrieval system