KEGG   Bradyrhizobium diazoefficiens USDA 110: blr1259Help
Entry
blr1259           CDS       T00109                                 

Gene name
maf
Definition
(RefSeq) Maf-like protein
  KO
K06287  
septum formation protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1373132..1373761
Genome map
AA seq 209 aa AA seqDB search
MLGRPKFVLASGSPRRLSLLNQAGIEPDALRPADVDETPKRGELPRACANRLARAKADAA
LKSVQLDDELRGAFILSADTVVAVGRRILPKANLVDEAAQCLRLLSGRNHRVYTAICLVT
PREAFRQRLVETRVRFKRLSEDDIQAYIGSGEWRGKAGGYAVQGIAGSFVVKMVGSYSNV
VGLPLYETTTLLGGEGFPIRFGWLNATAV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgcttggccgccccaaattcgtacttgcctccggttcgccgcggcgcctgtcgctgctc
aaccaggccggcatcgagccggatgcgctccggccggccgacgtcgacgagacgccgaag
cggggcgagctgccgcgcgcctgcgccaatcgcctcgcaagggccaaggcggatgcggcg
ctgaaatcggtgcagctcgacgacgaactgcgcggcgccttcatcctctccgccgacacg
gtggtggcggtcggccgccgcatcctgcccaaggctaacctcgtggacgaggcggcgcag
tgcctgcggctgctctcgggccgcaatcaccgcgtctacaccgcgatctgcctcgtcacg
cctcgcgaggccttccgccagcgcctggtcgagacccgcgtccgcttcaagcgcctgtcg
gaagacgacatccaggcctatatcggctccggcgaatggcgcggcaaagccggcggctac
gccgtgcagggcatcgccggctccttcgtggtgaagatggtggggtcctacagcaacgtt
gtcggcctgccgctctacgagaccacgacgctgctcggcggcgagggcttcccgatccgc
ttcggctggctcaacgccaccgccgtgtga

DBGET integrated database retrieval system