KEGG   Bradyrhizobium diazoefficiens USDA 110: blr1410Help
Entry
blr1410           CDS       T00109                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    blr1410 (glpK)
Enzymes [BR:bja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     blr1410 (glpK)
Exosome [BR:bja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   blr1410 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1536103..1537605
Genome map
AA seq 500 aa AA seqDB search
MSFVLAIDQGTTSSRAIVFRSDISIAARAQAEFPQHFPASGWVEHEPEDIWTSTVMVCRD
AIAQAGISAKDIAAIGITNQRETTVVWDRATGQAVHRAIVWQDRRTADICAKLKADGREP
VISEKTGLIIDPYFSGTKVAWILDHVPGARARAARGELMFGTVDCYLLWRLTGGKVHATD
ATNASRTLLFNIHTGQWDDELLEIIGVPRSMLPEVKDSSARFGESVPDLFGGAIAISGIA
GDQQAATIGQACFRPGMMKSTYGTGCFALLNTGTTPVVSKNKLLTTVAYQLDGKRTYALE
GSIFVAGSAVQWLRDGLGIIKHAAETGPLADQSDSMQSVYLVPAFVGMGAPYWNPRVRGA
LFGLTRNTGPAELAHAALESVCYQTFDLWAAMRADWPSSETASVVLRVDGGMTASDWTMQ
RLADLLDAPVDRPVIQETTALGAAYLAGLNAGVYPEPTKFADNWRLEHRFKPNMSEATRE
RKLAGWARAVKGVLASDEGA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcgtcctcgccatcgaccagggcaccacctcctcgcgcgcgatcgtgttccgc
agcgacatctcgattgctgcgcgtgcgcaagccgagtttccgcagcattttccggcctcg
ggctgggtcgagcacgagccggaggacatctggacctcgaccgtgatggtctgccgcgat
gcgatcgcgcaggccggcatcagcgcgaaggatatcgccgcgatcggcatcaccaaccag
cgcgagaccaccgtggtgtgggaccgcgccactgggcaggccgtgcaccgcgccatcgtc
tggcaggaccgccgcaccgccgacatctgcgcgaaactcaaggccgacggccgcgagcct
gtgatctccgagaagaccggcctgatcatcgatccctatttctccggcaccaaggtcgcc
tggatcctcgaccacgtgcccggcgcgcgtgcccgcgccgcgcgcggcgagctgatgttc
ggcaccgtcgactgctatttgctctggcgcctcaccggcggcaaggtccacgccaccgac
gccaccaacgcctcgcgcacgctgctgttcaacatccacaccggccagtgggacgacgaa
ctgctcgagatcatcggcgtgccgcgctcgatgctgcccgaggtgaaggattcgtccgcc
cgtttcggtgagagcgtgcccgacctgttcggcggcgcgatcgcgatctccggcatcgcc
ggcgaccagcaggccgcgaccatcggccaggcttgcttccgcccgggcatgatgaagtcc
acctacggcaccggctgcttcgcgctgctcaacaccggcaccacgcccgtggtgtcgaag
aacaagctgctcaccaccgtcgcctaccagctcgacggcaaacgtacctatgcgctcgaa
ggctcgatcttcgtcgccggcagcgcggtgcagtggctgcgcgacggcctcggcatcatc
aagcacgccgccgagaccggacctcttgctgatcagtccgactccatgcagagcgtctat
ctggtccccgccttcgtcggcatgggcgcgccctactggaatccgcgcgtgcgcggcgcg
ctgttcggcctcacccgcaacacgggacctgccgagctcgcccatgccgcgctggaaagc
gtctgctaccagaccttcgacctctgggccgcgatgcgcgccgactggccgagctcggaa
accgccagcgtcgtgctgcgcgttgacggcggcatgaccgcgtcggactggaccatgcag
cgcctcgccgatctcctcgacgcgccggtcgatcgccctgtgattcaggaaacgactgcg
ctcggcgccgcctatctcgccggcctcaatgcgggcgtctatcccgagccgaccaaattc
gccgacaactggcgcctcgagcaccgcttcaagccgaacatgagcgaggcaacgcgcgag
cggaagctcgcgggctgggcgcgagcggtgaagggcgtgctggcgagcgacgagggggcg
tga

DBGET integrated database retrieval system