KEGG   Bradyrhizobium japonicum USDA110: blr1488Help
Entry
blr1488           CDS       T00109                                 

Gene name
bdhA
Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bja00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bja00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1621669..1622457
Genome map
AA seq 262 aa AA seqDB search
MGSLSGKNAVVTGSTSGIGLAYARAFAAAGANVVINGFGSAEDIEKERAKIEADFGGKAI
YSPADMTKPAEIAGMIALGEKTFGSVDVLVNNAGIQFVSPIEEFPPEKWDQIIAINLSSA
FHAIRAAVPGMKKKGWGRIINTASAHSLVASPFKSAYVSAKHGIAGLTKTVALEVATHKI
TCNCISPGYVWTPLVEKQIPDTMKARNLTREQVINDVLLDAQPTKEFVTSEQVAALALFL
CSDDAAQITGTNLSIDGGWTAE
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggtagtctgtcaggcaagaacgccgtcgtgaccggatcgaccagcggtatcgggctc
gcctatgcgcgtgccttcgcggcggccggtgccaacgtcgtcatcaacggcttcggctcg
gccgaggacatcgagaaggaacgtgcgaagatcgaggcggacttcggcgggaaggcgatc
tactcgcccgccgacatgaccaagccggccgagatcgccgggatgatcgcgctcggcgag
aagaccttcggctcggtcgacgtcctcgtcaacaatgccggcatccagttcgtctcgccg
atcgaggaattcccgccggagaaatgggaccagatcatcgcgatcaacctgtcctcggcc
ttccatgccattcgcgccgcggtgcccggcatgaagaagaagggctggggtcgcatcatc
aacacggcgtcggcgcactcgctggtcgcctcgcccttcaagtcggcctacgtctcggcc
aagcacggcatcgccggtcttaccaagaccgtggcgctggaagtcgcgacccacaagatc
acctgcaactgcatcagccccggctatgtctggacgccgctggtcgagaagcagatcccc
gacacgatgaaggcgcgcaatctcacgcgtgagcaggtcatcaacgacgtgctgctcgac
gcccagccgaccaaggagttcgtcacctccgagcaggtcgccgcactggcgctgttcctg
tgcagcgacgatgccgcgcagatcaccggcaccaacctctcgatcgacggcggctggacg
gcggagtag

DBGET integrated database retrieval system