KEGG   Bradyrhizobium diazoefficiens USDA 110: blr1499Help
Entry
blr1499           CDS       T00109                                 

Gene name
exoN
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    blr1499 (exoN)
   00052 Galactose metabolism
    blr1499 (exoN)
   00500 Starch and sucrose metabolism
    blr1499 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    blr1499 (exoN)
Enzymes [BR:bja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     blr1499 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1633599..1634474
Genome map
AA seq 291 aa AA seqDB search
MKIRKAVFPVAGLGTRVLPATKAMPKEMLTIVDKPLIQYVYDEAREAGIEHFIFVTGRNK
NVIEDHFDKMFELDATLAARGKKAEQEILAQNQPEAGAVSFTRQQAPLGLGHAVWCARDI
VGNEPFAVVLPDELVLNTPGCLKQMIETASSLGDKSNLIAVEAVPDHLTHQYGICGVGKR
TGKMFEVDGMVEKPAKGTAPSNLSITGRYILQPEIFKILETQERGAGGEIQLTDAMIGLA
RSQKFYGVEFEGERHDCGSKPGFLRANIAYGLKRPELRDGLIAEMKKYLGQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccgcaaagccgtattccccgtcgccggcctcggcacccgcgtcctgcccgcc
accaaggcgatgccgaaggaaatgctgaccatcgtcgataagccgctgatccagtacgtc
tatgacgaggcgagggaagccggcatcgagcacttcatcttcgtcaccggccgcaacaag
aatgtcatcgaagatcatttcgacaagatgttcgagctcgacgcgacgctggctgcgcgc
ggcaagaaggccgagcaggagatcctggcgcagaaccagccggaagccggcgccgtcagc
ttcacccgccagcaggcgccgcttggtctcggtcacgcggtctggtgcgcccgcgacatc
gtcggcaacgagccgttcgcggtcgtgctgcccgacgagctcgtgctcaacacgcccggc
tgcctgaagcagatgatcgagacggcgtcctcgctcggcgacaaatccaacctgatcgcg
gtcgaggcagtgcccgaccatctcacccatcaatacggcatctgcggcgtcggcaagcgc
accggcaagatgttcgaggtcgacggcatggtcgagaagccggccaagggcaccgcgccc
tccaacctctccatcaccggccgctacatcctccagccggagatcttcaagatcctggag
acccaggagcgcggcgccggcggcgagatccagctcaccgacgccatgatcggcctcgcc
aggtcgcagaaattctacggcgtcgagttcgaaggcgagcgccatgattgcggctccaag
cccggcttcctccgcgccaacatcgcctacggcctgaagcgccccgagctgcgcgacggg
ttgatcgcggagatgaagaagtatctggggcagtga

DBGET integrated database retrieval system