KEGG   Bradyrhizobium diazoefficiens USDA 110: blr1721Help
Entry
blr1721           CDS       T00109                                 

Gene name
hupL
Definition
(RefSeq) uptake hydrogenase large subunit-like protein
  KO
K06281  
hydrogenase large subunit [EC:1.12.99.6]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Nitrotoluene degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    blr1721 (hupL)
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.99  With unknown physiological acceptors
    1.12.99.6  hydrogenase (acceptor)
     blr1721 (hupL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1890021..1891811
Genome map
AA seq 596 aa AA seqDB search
MAVQTPNGFNLDRSGKRIVIDPLTRIEGHLRIEANLDSDNVIRNAVSSGTIWRGIEVILR
GRDPRDAWAFTERICGVCTGTHALTSVRAVENALGITIPENANSIRNIMQLCLLVHDHLV
HFYHLHSLDWVDVVSALKDDPKSTSTLAQSISPWPLSSPGYFKDLQIRLGKFFGSGQLGP
FKNGYWGHPAYKLPPEANLIAVAHYLEALDFQKEIVKTQAIYGGKNPHPNWLVGGVPCAI
NIDGIGAVGAIGMERLNIISSIIDRSIEFVEQVYLPDIAAIFSYYKDWLHGGGLSSKSVM
SYGDIPEKANDCSGESFKLPRGVILDGNLKEILPIDHGDPEQIQEFVAHSWYKYPGHCCG
LLPWDGITEPSFELGPKLKGSKTDIKELDEGGKYSWIKAPRWRGRAVEVGPLARYIIGYA
QGKAEFKEPAERLLKGLNLPVTALFSTLGRTAARALECQWAAHQMRHFQDKLVINIKAGN
TATADISRWRPETWRKEAKGYGFTEAPRGALGHWITIKDAKIDNYQCVVPTTWNGSPRDS
SGNIGAFEASLIGTPMADPQRPLEILRTIHSFDPCLACSTHVMSHEGQEMASIRVR
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtccagacgccgaatgggttcaatctcgatcgttccggcaagcgaatcgttatc
gatccgctgactcgcatcgaaggccacctgcgcatcgaagctaatctcgattccgacaat
gtgatccgcaatgcagtctcaagcgggacgatttggcgtggcatcgaagtcatcctgcgt
gggcgcgatccgcgcgacgcatgggcgttcaccgagcggatttgcggggtctgcaccggt
acccatgcgctcacctccgtgcgcgcggttgaaaatgcactaggaattacgattccggag
aatgcaaattcgatccgcaacatcatgcagctgtgcctgctcgtgcatgatcacctcgta
catttctatcacctccattcgttggattgggtcgacgtggtctccgccctcaaggacgat
cccaagtcgacctctacactggcgcaatctatctcgccctggccgctgtcatcccctggc
tatttcaaggatctacagatccggctcggcaaattcttcggatcagggcaactcggtccg
ttcaagaatggctattgggggcatccggcctacaaactgccaccggaagcgaacctgata
gcggtagctcattatcttgaagcactcgacttccagaaggagatcgtcaaaacccaagcg
atttatggcggcaagaacccgcatccaaattggctggtgggcggcgtgccgtgcgcgatc
aacatcgacggaatcggagcggtgggcgcaatcggcatggagcgactgaacattatatcc
tccatcatcgaccgttcgatcgagtttgtcgagcaggtctatctgcccgacattgccgcg
atcttttcgtactataaggactggctccacggcggcggtctttcgagcaaaagcgtgatg
tcctatggcgatatccccgaaaaggccaatgactgttccggcgagagtttcaagctgccg
cgcggggtcattcttgatggcaatctcaaggagatattgccgatcgaccatggtgatccc
gaacagatccaggaattcgtcgcgcattcatggtataaataccccggccattgctgcgga
ctgcttccctgggatggtatcaccgagccgagttttgaacttgggccaaaactcaaaggc
agcaagacagatattaaagaactcgacgaaggcggcaaatattcctggatcaaagcgccg
cgatggcgcggccgcgccgtggaggttgggccgttggcccgatacattatcggttatgcg
caaggcaaagccgagttcaaggagcccgccgagagactgctcaaggggctcaatcttccc
gtgactgcgctgttctcgacccttggccgtactgcggcgcgggcgctcgaatgccaatgg
gcggcgcatcagatgcgccatttccaggataagctggtaatcaacatcaaggcgggcaac
acggcaactgccgatatcagcaggtggaggccggaaacctggcgcaaggaagccaaaggc
tacgggttcactgaggcgcctcgcggtgcgctcgggcactggattacgatcaaggacgct
aagattgacaactatcaatgtgtcgtgccgacgacatggaacggatctcctcgcgattca
agcggcaatattggcgcttttgaagcttcgctgatcggcactccgatggccgatccgcag
cgcccgttggagattttgcgcaccatccactcctttgatccgtgcttggcttgctcgacg
cacgtgatgagtcatgagggtcaagaaatggcctcaattagagttcgttag

DBGET integrated database retrieval system