KEGG   Bradyrhizobium diazoefficiens USDA 110: blr1994Help
Entry
blr1994           CDS       T00109                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    blr1994
   00500 Starch and sucrose metabolism
    blr1994
Enzymes [BR:bja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     blr1994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2152224..2153264
Genome map
AA seq 346 aa AA seqDB search
MRIFVSSAALLAGCFCIAAAYAHPLLVSHAGNADYHSVQQAIDALPAEGGNVRIAPGIYR
EKVKITKSGVHLAGTGNKPEDTVIVYGDGAVNVGGTARSATLDAPSDDFRLENLTIQNDY
ALNPANPPSQAVALSVTGDRDVITRVRLLGAQDTLFAGKGPNGRMSRQYFSNCYIEGHVD
FIFGNAKVWFRQCELHGIANQAVIYTAQSKATPDEDSGYVFDHCRLSADPAARYIALGRP
WRSYATVVFLSTKIDARVIAEGWREWAPGETNKLSTSYYAEYRSFGIGANPSGREPHSHQ
LKDGEAARWSLRVFFAGVTDWLPTNHQVRTKSNVHGEGVPRRSSDE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattttcgtttcctccgctgcacttctggcgggatgtttctgcatcgccgcggcg
tacgctcatccactgttggtgtcgcatgccggaaatgcagactatcactccgtgcagcaa
gccatcgacgcattgccggcggaaggcggaaacgtccggatcgcgccaggcatctatcgc
gagaaggttaaaatcacgaaatccggtgttcatctcgcagggactggcaacaagccggag
gatacggtcattgtgtatggcgacggcgcggtcaatgtaggaggaacggcccgttcggcg
acgctggatgcccctagcgatgacttccggctcgagaatctgaccattcagaacgactat
gccctcaatccggccaatccaccttcgcaggcggtagcgctgtccgttaccggagatagg
gacgtcattacgcgcgtccgcctgctcggcgcccaggacacgctgtttgccggcaaggga
ccaaacggtagaatgtcacgacaatacttctcgaactgctacatcgaagggcatgtcgat
ttcatatttggcaacgccaaggtctggttccggcaatgtgaattgcacggcatcgccaat
caagcggtcatctataccgctcagagcaaggcaacgccggatgaggacagtggctatgtt
tttgatcattgcaggctaagtgccgaccctgctgcgcgctatatcgcgcttggccgcccc
tggcgctcctacgccacagtggtcttcctgtcgacaaagatagatgcacgagtgattgcg
gaaggctggcgcgaatgggctcccggcgagaccaacaagttgagcacgagctattatgcc
gaatatagatccttcggcatcggtgctaacccatcaggccgcgagcctcattcccatcaa
ctgaaagatggcgaagctgcgagatggtcgctgagagtgttcttcgcgggtgtcacagat
tggctgcccacgaaccatcaggttcgaacaaagagcaatgttcacggtgaaggggttcca
cggcgatcctcggatgaatga

DBGET integrated database retrieval system