KEGG   Bradyrhizobium japonicum USDA110: blr1994Help
Entry
blr1994           CDS       T00109                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bja00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bja00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2152224..2153264
Genome map
AA seq 346 aa AA seqDB search
MRIFVSSAALLAGCFCIAAAYAHPLLVSHAGNADYHSVQQAIDALPAEGGNVRIAPGIYR
EKVKITKSGVHLAGTGNKPEDTVIVYGDGAVNVGGTARSATLDAPSDDFRLENLTIQNDY
ALNPANPPSQAVALSVTGDRDVITRVRLLGAQDTLFAGKGPNGRMSRQYFSNCYIEGHVD
FIFGNAKVWFRQCELHGIANQAVIYTAQSKATPDEDSGYVFDHCRLSADPAARYIALGRP
WRSYATVVFLSTKIDARVIAEGWREWAPGETNKLSTSYYAEYRSFGIGANPSGREPHSHQ
LKDGEAARWSLRVFFAGVTDWLPTNHQVRTKSNVHGEGVPRRSSDE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattttcgtttcctccgctgcacttctggcgggatgtttctgcatcgccgcggcg
tacgctcatccactgttggtgtcgcatgccggaaatgcagactatcactccgtgcagcaa
gccatcgacgcattgccggcggaaggcggaaacgtccggatcgcgccaggcatctatcgc
gagaaggttaaaatcacgaaatccggtgttcatctcgcagggactggcaacaagccggag
gatacggtcattgtgtatggcgacggcgcggtcaatgtaggaggaacggcccgttcggcg
acgctggatgcccctagcgatgacttccggctcgagaatctgaccattcagaacgactat
gccctcaatccggccaatccaccttcgcaggcggtagcgctgtccgttaccggagatagg
gacgtcattacgcgcgtccgcctgctcggcgcccaggacacgctgtttgccggcaaggga
ccaaacggtagaatgtcacgacaatacttctcgaactgctacatcgaagggcatgtcgat
ttcatatttggcaacgccaaggtctggttccggcaatgtgaattgcacggcatcgccaat
caagcggtcatctataccgctcagagcaaggcaacgccggatgaggacagtggctatgtt
tttgatcattgcaggctaagtgccgaccctgctgcgcgctatatcgcgcttggccgcccc
tggcgctcctacgccacagtggtcttcctgtcgacaaagatagatgcacgagtgattgcg
gaaggctggcgcgaatgggctcccggcgagaccaacaagttgagcacgagctattatgcc
gaatatagatccttcggcatcggtgctaacccatcaggccgcgagcctcattcccatcaa
ctgaaagatggcgaagctgcgagatggtcgctgagagtgttcttcgcgggtgtcacagat
tggctgcccacgaaccatcaggttcgaacaaagagcaatgttcacggtgaaggggttcca
cggcgatcctcggatgaatga

DBGET integrated database retrieval system