KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2030Help
Entry
blr2030           CDS       T00109                                 

Gene name
nodI
Definition
(RefSeq) nodulation factor exporter subunit NodI
  KO
K09695  
lipooligosaccharide transport system ATP-binding protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
ABC transporters
Module
Lipooligosaccharide transport system
Brite
KEGG Orthology (KO) [BR:bja00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    blr2030 (nodI)
Transporters [BR:bja02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipooligosaccharide transporter [MD:M00252] [OT]
    blr2030 (nodI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2189171..2190091
Genome map
AA seq 306 aa AA seqDB search
MNMSNMAIDLVGVRKSFGDKVIVNDLSFSVARGECFGLLGPNGAGKSTIARMLLGMISPD
RGKITVLDEPVPSRARAARVRVGVVPQFDNLEPEFTVRENLLVFGRYFGMSARTIEAVVP
SLLEFARLESKADVRVSLLSGGMKRRLTLARALINDPHLLVMDEPTTGLDPHARHLIWER
LRALLARGKTILLTTHFMEEAERLCDRLCVLESGCKIAEGKPDALIDEHIGCNVIEIYGG
DLDQLRELIRPYARHIEVSGETLFCYARCPDEISVHLRGRTDLRVLQRPPNLEDVFLRLT
GREMEK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgtccaatatggcgatcgaccttgtcggcgtgagaaagtcattcggggacaag
gttatcgtcaatgacctgtcgttctcggttgcgcgcggagagtgcttcgggctgcttggg
ccaaatggagctggcaaaagtacgattgcacgcatgctcctcggcatgatttcccccgat
cgaggcaagattacggtcctcgatgagcctgtgccttcccgcgctcgtgcggcgcgcgtg
cgcgtaggcgtggtgccgcagttcgataaccttgagcccgagttcaccgtgcgggagaac
ctgcttgtgtttggccgctatttcggcatgagcgctcgcacgatcgaagcggttgtgccc
tcgttgcttgagtttgcgcggcttgaaagcaaggcggacgtgcgcgtctcccttttgtcc
ggtggtatgaagcggcggctgacgctggcgcgcgctctgatcaatgatccacatctactc
gtgatggacgagccgacgacggggctcgatccgcatgctcgccacctgatctgggaacgc
ctgcgggctcttcttgcgcgcggcaagacgatcctcttgaccactcacttcatggaagag
gccgaacgcctttgcgatcggctatgcgtgcttgagagtggatgcaaaatcgccgaaggc
aagccagacgccttgatcgacgagcatatcggctgcaacgtgatcgagatctatggcggt
gatctagatcaactccgggagctgatcaggccgtatgcgcggcatatcgaagtgagtgga
gagacgcttttttgttacgcgcgatgtccggacgaaatcagcgtgcacctgcgcgggcga
acggaccttcgcgttctgcagcgccccccgaatctcgaagacgtgtttttgcggttgacc
gggcgcgagatggagaaatga

DBGET integrated database retrieval system