KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2036Help
Entry
blr2036           CDS       T00109                                 

Gene name
fixR
Definition
(RefSeq) oxidoreductase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2195172..2196008
Genome map
AA seq 278 aa AA seqDB search
MGLDLPNDNLIRGPLPEAHLDRLVDAVNARVDRGEPKVMLLTGASRGIGHATAKLFSEAG
WRIISCARQPFDGERCPWEAGNDDHFQVDLGDHRMLPRAITEVKKRLAGAPLHALVNNAG
VSPKTPTGDRMTSLTTSTDTWMRVFHLNLVAPILLAQGLFDELRAASGSIVNVTSIAGSR
VHPFAGSAYATSKAALASLTRELAHDYAPHGIRVNAIAPGEIRTDMLSPDAEARVVASIP
LRRVGTPDEVAKVIFFLCSDAASYVTGAEVPINGGQHL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgggtctcgatctgccaaatgacaatctgatccgaggtccgctgcccgaagcacatttg
gatcgcctcgttgacgctgttaatgcgcgcgttgatcgtggagaaccgaaggtgatgtta
ctcaccggcgcatcgcgcggaattggccatgccactgccaagctattctcggaggcaggc
tggcgcatcatttcttgcgcacgccaaccgttcgacggcgagcgatgcccctgggaggct
gggaatgacgatcatttccaggtcgacctcggcgatcatcgaatgctgccgcgcgcaatc
accgaggttaagaaacgcttggccggtgcgcccttgcacgcgctggtgaataatgcgggt
gtgtcgccgaaaacgcccacaggcgatcggatgacatcgttgaccacctcaaccgatacc
tggatgagggtctttcatcttaatctggtggctccgatcctgctggcgcagggtttgttt
gatgagctaagagccgcgtcaggatcgatcgtgaatgtgacttcaatcgcgggctcgcgg
gtgcacccattcgccggtagcgcctatgcgacctcgaaagctgcgcttgcgagcctcaca
cgcgaattggcccacgactatgcgccgcatggcattcgcgtcaatgcgatcgcgcccggc
gaaatcaggaccgacatgctgtcgcccgacgcggaagcgcgcgtcgtggcaagtatcccg
ctgcgcagagtgggtactccggacgaagtggccaaggtcatcttcttcctatgctcggat
gcggcgagctatgttacgggtgccgaggtgccgatcaacggtggccagcatctgtga

DBGET integrated database retrieval system