KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2036Help
Entry
blr2036           CDS       T00109                                 

Gene name
fixR
Definition
(RefSeq) oxidoreductase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short DUF1776 Epimerase
Motif
Other DBs
NCBI-GeneID: 1055516
NCBI-ProteinID: NP_768676
RhizoBase: blr2036
UniProt: P05406
Position
2195172..2196008
Genome map
AA seq 278 aa AA seqDB search
MGLDLPNDNLIRGPLPEAHLDRLVDAVNARVDRGEPKVMLLTGASRGIGHATAKLFSEAG
WRIISCARQPFDGERCPWEAGNDDHFQVDLGDHRMLPRAITEVKKRLAGAPLHALVNNAG
VSPKTPTGDRMTSLTTSTDTWMRVFHLNLVAPILLAQGLFDELRAASGSIVNVTSIAGSR
VHPFAGSAYATSKAALASLTRELAHDYAPHGIRVNAIAPGEIRTDMLSPDAEARVVASIP
LRRVGTPDEVAKVIFFLCSDAASYVTGAEVPINGGQHL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgggtctcgatctgccaaatgacaatctgatccgaggtccgctgcccgaagcacatttg
gatcgcctcgttgacgctgttaatgcgcgcgttgatcgtggagaaccgaaggtgatgtta
ctcaccggcgcatcgcgcggaattggccatgccactgccaagctattctcggaggcaggc
tggcgcatcatttcttgcgcacgccaaccgttcgacggcgagcgatgcccctgggaggct
gggaatgacgatcatttccaggtcgacctcggcgatcatcgaatgctgccgcgcgcaatc
accgaggttaagaaacgcttggccggtgcgcccttgcacgcgctggtgaataatgcgggt
gtgtcgccgaaaacgcccacaggcgatcggatgacatcgttgaccacctcaaccgatacc
tggatgagggtctttcatcttaatctggtggctccgatcctgctggcgcagggtttgttt
gatgagctaagagccgcgtcaggatcgatcgtgaatgtgacttcaatcgcgggctcgcgg
gtgcacccattcgccggtagcgcctatgcgacctcgaaagctgcgcttgcgagcctcaca
cgcgaattggcccacgactatgcgccgcatggcattcgcgtcaatgcgatcgcgcccggc
gaaatcaggaccgacatgctgtcgcccgacgcggaagcgcgcgtcgtggcaagtatcccg
ctgcgcagagtgggtactccggacgaagtggccaaggtcatcttcttcctatgctcggat
gcggcgagctatgttacgggtgccgaggtgccgatcaacggtggccagcatctgtga

DBGET integrated database retrieval system