KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2053Help
Entry
blr2053           CDS       T00109                                 

Definition
(RefSeq) transposase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2214422..2214727
Genome map
AA seq 101 aa AA seqDB search
MDLIQIEVRSGRYEDQSMKRSRFTEEQIIGILKEHEAGVSVADLCRKHGVSDASIYKWKA
KCGGMEVSEAKRLRTLEDENTRLKRLLADRGRPRDERTAGV
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
gtggacttaatccagattgaagttcgctctggccgatatgaggaccagagcatgaagcgc
agccgctttacggaagagcagatcatcgggattttgaaggagcacgaagctggcgtgtcg
gttgccgatctgtgccggaagcacggcgtcagcgatgccagcatctacaaatggaaagcc
aagtgtggcgggatggaggtctcggaggccaagcggctgaggacgctggaggatgagaac
acgcggctgaagcggcttttggccgatcgtggacgcccacgggatgagcgaacggcgggc
gtgtaa

DBGET integrated database retrieval system