KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2057Help
Entry
blr2057           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2217794..2218213
Genome map
AA seq 139 aa AA seqDB search
MRAQVVDKLEAGRVQHGRFATAPGSGPCGLFFVQGPCGCELKISAFVRPGWEHVAVSTPR
RCPNWEEMCFVKDMFWDEEECVMQLHPPHSRYVNNSRYCLHLWRPIYRDIPMPSPSFVGV
VGLSPSDAATLFARMSATA
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagcgcaggtggtagacaagctggaggcgggccgggtgcagcatggccggttcgcg
actgctccgggatcaggcccttgcggtctcttctttgtgcaggggccttgcgggtgtgaa
ctaaagataagtgcatttgtccgtcctgggtgggagcatgtcgctgtttcgacaccgcgg
cgttgtccaaactgggaggagatgtgctttgtcaaagacatgttctgggatgaagaagag
tgcgtcatgcaactgcatccgccacattcgcgttatgtgaataacagccgatattgcctt
catttgtggagacccatttatcgagacattccgatgccgtctccgagcttcgtaggcgtc
gttggattgagtccctcagatgcggcaacgttgttcgcgcggatgagcgcgacagcatga

DBGET integrated database retrieval system