KEGG   Bradyrhizobium japonicum USDA110: blr2333Help
Entry
blr2333           CDS       T00109                                 

Gene name
pcaH
Definition
protocatechuate 3,4-dioxygenase subunit beta
Orthology
K00449  
protocatechuate 3,4-dioxygenase, beta subunit [EC:1.13.11.3]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Benzoate degradation
Polycyclic aromatic hydrocarbon degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:bja01220]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:bja00362]
Metabolism; Xenobiotics biodegradation and metabolism; Polycyclic aromatic hydrocarbon degradation [PATH:bja00624]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2534860..2535648
Genome map
AA seq 262 aa AA seqDB search
MNAQATALQDPRLNRAEPFTPPLGDGGFFQRDRSIHPPAYAPGYKSSVLRSPRQALLSLE
NSVSEITGPVFGHNDLGPLDNDLIRNYAKDGDPVGERIIVHGRVLDETGRGVPNTLVEFW
QANAGGRYRHKKDTYLAPIDPNFGGCGRALTDDTGYYYFRTVKPGPYPWRNFVNSWRPAH
IHFSVFGSGFAQRLITQMYFEGDPLIPVCPILTTIPDKDALDRLVAPLDLNASTPFDSLA
YRFDIVLRGQRSTYFENRTEGN
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcccaggcgacagccttgcaggatccccgcctcaaccgcgccgagccgttcacg
ccgccgctcggcgacggcggcttcttccagcgcgaccgttccatccatccgcccgcgtat
gctcccggctacaaatcctcggtgctgcgctcgccgcgccaggcgctgctgtcactggag
aattcggtctcggaaatcacgggaccggtgttcggccacaacgatctcggcccgctcgac
aacgacctgatccgcaactacgccaaggacggcgatcccgtcggcgagcgcatcatcgtc
cacggtcgcgtgctggacgagaccggccgcggcgttccgaacacgctggtcgaattctgg
caggccaatgccggcggccgctaccggcacaagaaggacacgtatctggcgccgatcgat
ccgaatttcggcggctgcggccgcgcgctgactgacgacaccggctattattatttccgc
accgtgaagccgggtccttatccctggcgcaacttcgtcaacagctggcgtcccgcccac
atccacttctcggtgttcggctcgggctttgcgcagcggctgatcacgcagatgtatttc
gagggcgatcccctgatcccggtctgcccgatcctgacgacgattccggacaaggatgcg
ctcgatcgcctggtcgcgccgctcgacctcaacgcctcgacaccgttcgattcgctcgcc
taccgtttcgacatcgtcctgcgcggccagcgctccacctatttcgaaaaccgcaccgag
gggaactga

DBGET integrated database retrieval system