KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2333Help
Entry
blr2333           CDS       T00109                                 

Gene name
pcaH
Definition
protocatechuate 3,4-dioxygenase subunit beta
Orthology
K00449  
protocatechuate 3,4-dioxygenase, beta subunit [EC:1.13.11.3]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Benzoate degradation
Polycyclic aromatic hydrocarbon degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    blr2333 (pcaH)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    blr2333 (pcaH)
   00624 Polycyclic aromatic hydrocarbon degradation
    blr2333 (pcaH)
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.3  protocatechuate 3,4-dioxygenase
     blr2333 (pcaH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2534860..2535648
Genome map
AA seq 262 aa AA seqDB search
MNAQATALQDPRLNRAEPFTPPLGDGGFFQRDRSIHPPAYAPGYKSSVLRSPRQALLSLE
NSVSEITGPVFGHNDLGPLDNDLIRNYAKDGDPVGERIIVHGRVLDETGRGVPNTLVEFW
QANAGGRYRHKKDTYLAPIDPNFGGCGRALTDDTGYYYFRTVKPGPYPWRNFVNSWRPAH
IHFSVFGSGFAQRLITQMYFEGDPLIPVCPILTTIPDKDALDRLVAPLDLNASTPFDSLA
YRFDIVLRGQRSTYFENRTEGN
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcccaggcgacagccttgcaggatccccgcctcaaccgcgccgagccgttcacg
ccgccgctcggcgacggcggcttcttccagcgcgaccgttccatccatccgcccgcgtat
gctcccggctacaaatcctcggtgctgcgctcgccgcgccaggcgctgctgtcactggag
aattcggtctcggaaatcacgggaccggtgttcggccacaacgatctcggcccgctcgac
aacgacctgatccgcaactacgccaaggacggcgatcccgtcggcgagcgcatcatcgtc
cacggtcgcgtgctggacgagaccggccgcggcgttccgaacacgctggtcgaattctgg
caggccaatgccggcggccgctaccggcacaagaaggacacgtatctggcgccgatcgat
ccgaatttcggcggctgcggccgcgcgctgactgacgacaccggctattattatttccgc
accgtgaagccgggtccttatccctggcgcaacttcgtcaacagctggcgtcccgcccac
atccacttctcggtgttcggctcgggctttgcgcagcggctgatcacgcagatgtatttc
gagggcgatcccctgatcccggtctgcccgatcctgacgacgattccggacaaggatgcg
ctcgatcgcctggtcgcgccgctcgacctcaacgcctcgacaccgttcgattcgctcgcc
taccgtttcgacatcgtcctgcgcggccagcgctccacctatttcgaaaaccgcaccgag
gggaactga

DBGET integrated database retrieval system