KEGG   Bradyrhizobium japonicum USDA110: blr2349Help
Entry
blr2349           CDS       T00109                                 

Gene name
cheB
Definition
chemotaxis two-component response regulator
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bja02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bja02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2552395..2553486
Genome map
AA seq 363 aa AA seqDB search
MPREKVRVLIVDDSASVRQILQTILNDDPDIEVMGTASDPFAAARRLQNEIPDVMILDIE
MPRMDGMTFLRKIMAQRPIPVIICSSLTEEGSNVMFEAFEAGAVDIVPKPKIDTRQALLE
CSTRLREAVKSAARARVRPRAERRVVEKKLTADAIIPPPVQGKVRPTTERIVCIGASTGG
TEALNDVLEMLPPHCPPLLIVQHMPAGFTAAFARRLDSVCQIRVKEAEDGEPVLPGSAYI
APGARHMLLQRIGLRYQIAIKDGPPVSRHRPSVDVLFRSAAQHAGANALGVIMTGMGDDG
ARGMLEMRKLGASTRAQDEDSCVVFGMPKEAIAHGGVEKVVPLHHIPREIMLWYQAGHVA
VAG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgccgagggagaaagttcgcgtgctgatcgtggacgattcggcgtcggtgcgccaaatc
cttcagacgatcctcaatgacgatccggacatcgaggtgatggggaccgcgtccgacccg
ttcgcagccgcgcgccgcctccagaacgagatccccgacgtcatgatcctcgacatcgag
atgccgcgcatggacggcatgacgttcctgcgcaagatcatggcgcaacgtccgatcccg
gtgatcatctgctcctcgctgaccgaagaaggctcgaacgtgatgttcgaagcgttcgag
gcgggcgcggtcgacatcgtgccgaagccgaagatcgacacgcggcaggcgctgctcgaa
tgctccacgcggctgcgcgaggccgtcaagtcggcggcgcgcgcccgcgtgcgcccgcgt
gcggagcgccgggtggtcgagaagaagctgacggccgacgccatcatcccgccgccggtg
cagggcaaggtccggccgacgacggagcgcatcgtgtgcatcggcgcatcgacgggcggc
accgaagcgctcaacgacgtcctcgagatgctgccgccgcactgccctccgcttctcatc
gttcagcacatgccggcggggttcaccgcggcgtttgcaagacgtctcgacagcgtctgc
cagatccgggtcaaggaggccgaggacggcgagccggtgctgccgggcagcgcctatatt
gccccgggcgcccgtcacatgctgcttcagcgtatcgggctgcgctaccagattgcgatc
aaggacggtccgccggtgtcgcggcatcgcccctcagtcgacgtgctgttccgctcggcg
gcccagcacgccggcgccaacgcgctcggcgtcatcatgaccggcatgggcgacgatggc
gcgcgcggaatgctggagatgcgcaagctcggcgcctcgacgcgagcacaggatgaagac
agctgcgtggtgttcggcatgcccaaggaagccatcgcccatggcggggtcgagaaggtc
gtgccgctgcaccatattccgcgcgagatcatgctctggtatcaggccgggcacgtcgcg
gtggcaggttga

DBGET integrated database retrieval system