KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2455Help
Entry
blr2455           CDS       T00109                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    blr2455
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    blr2455
Enzymes [BR:bja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     blr2455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2676138..2677916
Genome map
AA seq 592 aa AA seqDB search
MLHDITNKKQAIYTKFPFSRLRRDTHFAMHCQECRWPAIAIVSERIRHMNYQPRGISTFQ
APASYQSEIDAAKALLETQPTWNGVSAEAVARMRLQNRFRTGLDVARYTAALMRADMAAY
DNDPTKYTQSLGCWHGFIAQQKLISVKKHFGGRTDRTYLYLSGWMIAALRSEFGPLPDQS
MHEKTSVPALIEELYTFLRQADSRELNDIFRSLDKARKEGDKTREKELIEKIDGFQTHVV
PVIADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQDGKVTVPHDVFLAK
IRACRHAFLELGVEDGVVVTRTDSLGAGLTQQIAVSHKPGDIGDQYNSFLDCEEITAENA
RNGDVIINRNGKMMRPKRLPSNLYQFRPGTGEDRCVLDCITSLQNGADLLWIETEKPHIE
QIAKMVDRIREVVPNAKLAYNNSPSFNWTLNFRWQVYDAMKEAGKDVSKYNRAELMKAEY
DDTPLAKEADERIRTFQADSAKRAGIFHHLITLPTYHTAALSTDNLAREYFGEQGMLGYV
KNVQRAEIRQGIACVKHQNMAGSDIGDDHKEYFAGEAALKAGGAHNTMNQFG
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgttacatgacatcaccaataaaaaacaagccatctatacgaagtttccgttttcgcgt
ttacgtcgtgacacgcatttcgcaatgcactgtcaagaatgtcgatggccagccatcgcc
atcgtcagcgaaaggatcaggcacatgaactaccagccccgtggcatcagcactttccag
gcgccggcctcgtatcagagcgagatcgatgcagcgaaggcgctcctcgagacccagccg
acctggaacggggtgtcggccgaggccgtcgcgcgcatgcgcctgcagaaccgcttcagg
accggcctcgacgtcgcccgctacaccgcggcgctgatgcgggccgacatggcggcctat
gacaacgaccccaccaagtacacccagtcgctcggctgctggcacggcttcatcgcccag
cagaagctgatctcggtcaagaagcacttcggtggcaggaccgatcgcacctacctgtat
ctctccggctggatgatcgcggcgctgcgctccgagttcggaccgctgcccgaccagtcg
atgcacgagaagacctcggtgccggcgctgatcgaagagctctacaccttcctgcgccag
gccgactcgcgcgagctcaacgacatcttccgcagcctcgacaaggcccgcaaggaaggt
gacaagacgcgcgagaaggagctgatcgagaagatcgacggcttccagacccatgtcgtg
cccgtcatcgccgacatcgatgccggcttcggcaacgcggaggcgacctacctgctcgcc
aagaagatgatcgaagcgggcgcctgcgcgctccagatcgagaaccaggtctcggacgag
aagcagtgcggccaccaggacggcaaggtcaccgtgccgcacgatgtcttcctggcgaag
atccgcgcctgccgccacgccttcctcgagctcggcgtcgaagacggcgtcgtcgtgacc
cgcaccgactcgctcggcgctggcctcacgcagcagatcgccgtcagccacaagcccggc
gacatcggcgaccagtacaacagcttcctcgattgcgaggaaatcaccgcggagaacgcc
cgcaacggcgacgtcatcatcaaccgcaacggcaagatgatgcgtccgaagcggctgccc
tccaacctctaccagttccgcccgggcaccggtgaggaccgctgcgtgctggattgcatc
acctcgctgcagaacggcgccgacctgctctggatcgagaccgagaagccgcatatcgag
cagatcgccaagatggtcgatcgcatccgcgaggtggttccgaacgccaagctggcctac
aacaactcgccgtcgttcaactggaccctcaacttccgttggcaggtctacgacgcgatg
aaggaagccggcaaggacgtcagcaagtacaaccgcgccgagctgatgaaggcggaatat
gacgacacgccgctggcgaaggaagccgacgagcgcatccgcaccttccaggcggattcg
gccaagcgtgccggcatcttccaccacctgatcacgctgccgacctaccacaccgcggcg
ctttcgaccgacaatctggcccgggagtacttcggcgagcagggcatgctcggctacgtc
aagaacgtccagcgcgccgagatccgtcagggcatcgcctgcgtgaagcatcagaacatg
gccggctccgacatcggcgacgaccacaaggagtacttcgccggcgaggccgccctgaag
gcgggcggcgcgcacaacacgatgaaccagttcggctaa

DBGET integrated database retrieval system