KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2455Help
Entry
blr2455           CDS       T00109                                 

Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    blr2455
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    blr2455
Enzymes [BR:bja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     blr2455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2676138..2677916
Genome map
AA seq 592 aa AA seqDB search
MLHDITNKKQAIYTKFPFSRLRRDTHFAMHCQECRWPAIAIVSERIRHMNYQPRGISTFQ
APASYQSEIDAAKALLETQPTWNGVSAEAVARMRLQNRFRTGLDVARYTAALMRADMAAY
DNDPTKYTQSLGCWHGFIAQQKLISVKKHFGGRTDRTYLYLSGWMIAALRSEFGPLPDQS
MHEKTSVPALIEELYTFLRQADSRELNDIFRSLDKARKEGDKTREKELIEKIDGFQTHVV
PVIADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQDGKVTVPHDVFLAK
IRACRHAFLELGVEDGVVVTRTDSLGAGLTQQIAVSHKPGDIGDQYNSFLDCEEITAENA
RNGDVIINRNGKMMRPKRLPSNLYQFRPGTGEDRCVLDCITSLQNGADLLWIETEKPHIE
QIAKMVDRIREVVPNAKLAYNNSPSFNWTLNFRWQVYDAMKEAGKDVSKYNRAELMKAEY
DDTPLAKEADERIRTFQADSAKRAGIFHHLITLPTYHTAALSTDNLAREYFGEQGMLGYV
KNVQRAEIRQGIACVKHQNMAGSDIGDDHKEYFAGEAALKAGGAHNTMNQFG
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgttacatgacatcaccaataaaaaacaagccatctatacgaagtttccgttttcgcgt
ttacgtcgtgacacgcatttcgcaatgcactgtcaagaatgtcgatggccagccatcgcc
atcgtcagcgaaaggatcaggcacatgaactaccagccccgtggcatcagcactttccag
gcgccggcctcgtatcagagcgagatcgatgcagcgaaggcgctcctcgagacccagccg
acctggaacggggtgtcggccgaggccgtcgcgcgcatgcgcctgcagaaccgcttcagg
accggcctcgacgtcgcccgctacaccgcggcgctgatgcgggccgacatggcggcctat
gacaacgaccccaccaagtacacccagtcgctcggctgctggcacggcttcatcgcccag
cagaagctgatctcggtcaagaagcacttcggtggcaggaccgatcgcacctacctgtat
ctctccggctggatgatcgcggcgctgcgctccgagttcggaccgctgcccgaccagtcg
atgcacgagaagacctcggtgccggcgctgatcgaagagctctacaccttcctgcgccag
gccgactcgcgcgagctcaacgacatcttccgcagcctcgacaaggcccgcaaggaaggt
gacaagacgcgcgagaaggagctgatcgagaagatcgacggcttccagacccatgtcgtg
cccgtcatcgccgacatcgatgccggcttcggcaacgcggaggcgacctacctgctcgcc
aagaagatgatcgaagcgggcgcctgcgcgctccagatcgagaaccaggtctcggacgag
aagcagtgcggccaccaggacggcaaggtcaccgtgccgcacgatgtcttcctggcgaag
atccgcgcctgccgccacgccttcctcgagctcggcgtcgaagacggcgtcgtcgtgacc
cgcaccgactcgctcggcgctggcctcacgcagcagatcgccgtcagccacaagcccggc
gacatcggcgaccagtacaacagcttcctcgattgcgaggaaatcaccgcggagaacgcc
cgcaacggcgacgtcatcatcaaccgcaacggcaagatgatgcgtccgaagcggctgccc
tccaacctctaccagttccgcccgggcaccggtgaggaccgctgcgtgctggattgcatc
acctcgctgcagaacggcgccgacctgctctggatcgagaccgagaagccgcatatcgag
cagatcgccaagatggtcgatcgcatccgcgaggtggttccgaacgccaagctggcctac
aacaactcgccgtcgttcaactggaccctcaacttccgttggcaggtctacgacgcgatg
aaggaagccggcaaggacgtcagcaagtacaaccgcgccgagctgatgaaggcggaatat
gacgacacgccgctggcgaaggaagccgacgagcgcatccgcaccttccaggcggattcg
gccaagcgtgccggcatcttccaccacctgatcacgctgccgacctaccacaccgcggcg
ctttcgaccgacaatctggcccgggagtacttcggcgagcagggcatgctcggctacgtc
aagaacgtccagcgcgccgagatccgtcagggcatcgcctgcgtgaagcatcagaacatg
gccggctccgacatcggcgacgaccacaaggagtacttcgccggcgaggccgccctgaag
gcgggcggcgcgcacaacacgatgaaccagttcggctaa

DBGET integrated database retrieval system