KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2507Help
Entry
blr2507           CDS       T00109                                 

Definition
(RefSeq) chemotaxis protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal HAMP 4HB_MCP_1 DUF948 DUF1664 Reo_sigmaC COG5 DUF3450
Motif
Other DBs
NCBI-GeneID: 1050348
NCBI-ProteinID: NP_769147
RhizoBase: blr2507
UniProt: Q89S98
Position
2735001..2737016
Genome map
AA seq 671 aa AA seqDB search
MQMPSLRFRIRGRLYAGFSVLVVVGLIMAAVAIWNLWAVQGQMARLSALSDNTARVQEIS
INLQALRRANLRYIYDANEPAFKEAAEREGATVELLKDAAKSTVSEERLKIYNGLIGDVE
KMKSLRESMGTAVNETAKGKAVLLAGGDELTANSGKLVDAARETGDTSVTAPVADLESKI
LLVRVANWRFLAVRDAKGPATFRTNVDRAQQALKSLQEAGLPDEVKVAFGPIKSSLSAYK
AAFETTSAAILQADEIYRNSIAPLIGESVDKLKMAETGLKADYQKSRAAADGVIANTTWI
QEVAGGLAILFGSLVAFLIARSIVGPLTTMTRAMGALAGGDLKVEIPGRGNRDEIGDMAK
AIQVFKESMVETERLRHEQVEVEARQAEGRKKDMVRLADQFEQAVGEIVDTVSSASNELE
ASAGTLTTTASRAQDLSTEVASASQEASANVQAVASATEELSSSVSEIARQVQESARIAS
EAVGQASRTNDRVGELSKAAARIGDVVELISTIAGQTNLLALNATIEAARAGEAGRGFAV
VASEVKALAEQTAKATGEIGQQISNIQAATEQSVGAIREISGTIERLSEISSTVAAAVEQ
QGAATQEISRNVQQAAHGTQRVSTNIGDVQRGASETGSASSQVLSAARSLSADSNRLKQE
VARFLNSVHAA
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
gtgcagatgccgagcttgcgtttcagaatccgggggcgtctctacgccggattttcggtt
ctcgttgtcgttggcttgatcatggccgcggtcgcgatctggaatttgtgggcggtccag
ggccagatggcgcggctatccgcactctcggacaacacggcccgcgtccaggaaatctcg
atcaacctccaggcgctgcggcgcgccaatctccgctacatctatgacgccaacgagccg
gccttcaaggaggctgcggagcgggagggggcgacggtggagctgctgaaggacgcggcc
aagtcgacggtctccgaggagcggctcaagatctacaatggcctgatcggtgacgtcgaa
aagatgaagtccctgcgcgagagcatgggcaccgccgtcaacgagacggcgaaaggcaag
gctgttctgctcgccggcggggatgagctgaccgccaatagcggcaagctcgtcgacgcc
gcgcgtgaaactggcgataccagcgtgaccgcccctgtcgccgatctcgaatccaagatc
ctgctggttcgtgtcgcaaactggcgcttcctcgccgtccgggacgcaaaggggccggcg
accttcaggaccaatgtcgatcgggcgcagcaagcgctcaagtcactgcaggaggccggt
ctgccggacgaggtcaaggtcgcgttcggaccgatcaagagctcgctttcggcctacaag
gcggcgttcgagacgacctccgccgcaatcctccaggccgatgaaatctaccgcaacagt
atcgctcccctgatcggcgaaagcgtcgacaagctcaagatggcggagaccggattgaag
gccgactaccagaagtcgcgcgcggccgccgatggcgtcattgccaatacgacctggatc
caggaagtcgccggcggccttgcgatcctgttcggcagcctcgtcgccttcctgatcgcg
cgcagcatcgtcggaccgctgaccacgatgacccgggcgatgggagccctcgccggtggc
gatctcaaggtcgagattccgggccgtggcaatcgcgacgagatcggcgacatggccaag
gcgatccaggtgttcaaggagagcatggtcgagaccgagcgcctgcgtcacgagcaggtc
gaggtcgaggcgcggcaggccgagggccgcaagaaagacatggtccggctcgccgaccag
ttcgagcaggcggtcggcgagatcgtcgacaccgtgtcgtcggcatcgaacgagttggag
gcctcggccggcacgttgaccacgaccgcctcgcgggcccaggacctgtccacggaagtc
gccagcgcctcacaagaggcctcggccaacgtacaggcggttgcctccgcgaccgaggag
ctgtcctcctcggtttcggagatcgcccgccaggtgcaggaatccgcccgcatcgccagc
gaggcggtggggcaggcgagcaggaccaacgaccgggtcggcgagctctccaaggcggcc
gcccgcatcggcgacgtggtcgagctgatcagcaccatcgcgggccagaccaatctgctg
gcgctgaacgccaccatcgaggcggcgcgcgcgggcgaggccggccgcggctttgccgtg
gtcgcctccgaggtcaaggcgctggccgagcagaccgcgaaagcgaccggtgagatcggc
cagcagatttccaacatccaggccgctaccgagcaatccgtcggcgccatcagggagatc
agcggcaccatcgagcggctgtcggagatttcctcgacggtcgcggcggccgtggagcag
cagggcgcggcgacgcaggagatctcccgcaacgtccagcaggcggcccacggcacccag
cgcgtttccaccaatatcggcgacgtgcagcgcggtgcctccgagaccggttcggcctcc
tcgcaggtgctctcggcggcgcgctcgctgtcggccgacagcaaccggctgaagcaggag
gtcgccaggttcctgaactcggtccacgccgcctga

DBGET integrated database retrieval system