KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2519Help
Entry
blr2519           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM DUF4917 DUF1848
Motif
Other DBs
NCBI-GeneID: 1050350
NCBI-ProteinID: NP_769159
RhizoBase: blr2519
UniProt: Q89S86
Position
2752332..2753495
Genome map
AA seq 387 aa AA seqDB search
MSPASSHALKHPPVTAPSEPAGAPSDFPELAVAIDKQRRRGRGAQSNASGRYEAEARVAF
DDGWQSLEELPPFKTTVAVDTSRKVITRNDSPDIGFDRSINPYRGCEHGCVYCFARPTHA
YLGLSPGLDFESKLFVKPEAPALLEKELAAAGYEPRMIAIGTNTDPYQPIERERKIMRGI
LEVLERAGHPVGIVTKSALVARDIDILSRMAKRNLAKVAISVTSLDPKLARTMEPRASTP
PKRLEALKQLSDAGIPTTVMVAPVIPALNDSEIERILDAAAHAGVKEASYVLLRLPLEVR
DLFREWLMANYPDRYRHVFTLIRDMRGGRDYDAKWGERMKGTGPMAWTIGRRFEIACDRL
GLNKRRAKLTMDHFARPKRNGDQLSLF
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagtccagcatcctctcatgctctcaagcacccgccggtcacggcgccctccgagccg
gcgggtgcgccttctgatttccccgagctcgctgtcgccatcgacaagcagcgcaggcgg
gggcggggcgcgcagtccaacgccagcggccgctatgaggccgaggcgcgcgtcgccttc
gacgacggctggcagagcctggaagagctgccgccgttcaagaccacggtcgcggtcgac
acctcgcgcaaggtgatcacccgcaacgattcgcccgatatcggcttcgaccgctcgatc
aacccctatcgcggctgcgagcacggctgcgtctactgcttcgcgcggccgacccatgcc
tatctcggcctgtcgcccgggctcgacttcgagtcaaaactgttcgtcaagccggaggcc
ccggcgctgctcgagaaggagctcgcagcagcaggctatgagccgcggatgatcgcgatc
ggcaccaacaccgatccctatcagccgatcgagcgcgagcgcaaaatcatgcgcggcatc
ctggaggtgctggagcgcgctggtcatcccgtcggcatcgtcaccaaatcggcgctggtg
gcgcgtgacatcgacattctctcgcgcatggccaagcgcaacctcgccaaggtcgcgatc
tcggtgacttcgctcgatccaaagctggcgcgcaccatggagccgcgggcctcgacgccg
ccgaagcggttggaggcgctgaagcagctctccgatgccggcattcccaccaccgtgatg
gtcgcgccagtgattcccgcgctgaacgattccgagatcgagcgaattctcgatgcggcc
gcccatgccggcgtcaaggaagcctcctacgtgctgctgcggctgccgctggaggtgcgc
gacctcttccgcgaatggctgatggcgaactatccggaccgctatcgccacgtcttcacg
ttgatccgcgacatgcgcggcggccgcgactacgacgcgaaatggggcgagcgcatgaag
ggcaccggcccgatggcctggaccatcggccgccgcttcgagatcgcctgcgacaggctg
gggctcaacaagcgtcgcgcaaaactgacgatggatcacttcgcgcggccgaagcggaac
ggcgatcagctcagcctgttctag

DBGET integrated database retrieval system