KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2526Help
Entry
blr2526           CDS       T00109                                 

Gene name
ipk
Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00900  Terpenoid backbone biosynthesis
bja01100  Metabolic pathways
bja01110  Biosynthesis of secondary metabolites
bja01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    blr2526 (ipk)
Enzymes [BR:bja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     blr2526 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-GeneID: 1050340
NCBI-ProteinID: NP_769166
RhizoBase: blr2526
UniProt: Q89S79
Position
2761436..2762329
Genome map
AA seq 297 aa AA seqDB search
MSPMPALIEEGRAKVNLSLRVVGRRADGYHDLESVVAFADCADRLTLEPGGELKLATTGP
LAAACGDTADNLVFKAAKLLAEAVPNLKLGAFALDKVLPVAAGIGGGSADAAAALRLLAR
LNNLSLDDPRLQKVALATGADVPVCLYSRACDMTGVGEQLLPLALPSMPCVMVNPRVPVA
TKDVFQALGLRNGELLVGATSVIGAPAWPEEGASIADWVEVLETVANDLEAPAMRIEPVI
GEVLEALRDSAGVKLARMSGSGATCFAIYGAPAEAHAAAEKIRRDHPGWWVHAGTLS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccgatgccggcgttgattgaagaggggcgcgcgaaggtcaatctgagccttcgc
gtggtcggccgtcgtgccgacggctatcatgatctcgaaagcgtggtggcgtttgccgat
tgcgccgaccggctcacgttggagccgggcggcgagctgaagctcgccaccaccgggccg
ctggccgcagcatgcggcgatactgccgacaatctcgtgttcaaggccgcaaagcttctg
gccgaggccgtgccgaacctgaagctgggcgcctttgcgctcgacaaggtgctgcccgtc
gcggccggcatcggcggtggctcggcggatgcagcggcagcgctgcggctgctggcgcgt
ctcaacaacctgtcgctcgatgatccccgcctccagaaggtcgcgctcgcgaccggcgcc
gacgtgccggtgtgcctgtattcgcgcgcctgcgacatgaccggcgtcggcgagcagctg
ctgccgctcgcgctgccgagcatgccctgcgtgatggtcaatccgcgcgtgccggtcgcg
accaaggacgtgttccaggcgctgggcctgcgcaacggcgagctgctggtcggcgccacc
tccgtcatcggagccccggcctggccggaggagggcgcctcgattgccgactgggtcgag
gttctcgaaaccgtcgccaacgacctcgaagcccccgcgatgcgcatcgaacctgtcatc
ggcgaggtgctggaggcgctacgcgactccgccggcgtcaagctcgcccgcatgtccggc
tcgggcgcgacctgctttgcgatctatggcgcgccggccgaggcacatgctgccgcggaa
aagatccggcgcgatcaccccggctggtgggtgcatgcggggacgttgagctaa

DBGET integrated database retrieval system