KEGG   Bradyrhizobium japonicum USDA110: blr2526Help
Entry
blr2526           CDS       T00109                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bja00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2761436..2762329
Genome map
AA seq 297 aa AA seqDB search
MSPMPALIEEGRAKVNLSLRVVGRRADGYHDLESVVAFADCADRLTLEPGGELKLATTGP
LAAACGDTADNLVFKAAKLLAEAVPNLKLGAFALDKVLPVAAGIGGGSADAAAALRLLAR
LNNLSLDDPRLQKVALATGADVPVCLYSRACDMTGVGEQLLPLALPSMPCVMVNPRVPVA
TKDVFQALGLRNGELLVGATSVIGAPAWPEEGASIADWVEVLETVANDLEAPAMRIEPVI
GEVLEALRDSAGVKLARMSGSGATCFAIYGAPAEAHAAAEKIRRDHPGWWVHAGTLS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccgatgccggcgttgattgaagaggggcgcgcgaaggtcaatctgagccttcgc
gtggtcggccgtcgtgccgacggctatcatgatctcgaaagcgtggtggcgtttgccgat
tgcgccgaccggctcacgttggagccgggcggcgagctgaagctcgccaccaccgggccg
ctggccgcagcatgcggcgatactgccgacaatctcgtgttcaaggccgcaaagcttctg
gccgaggccgtgccgaacctgaagctgggcgcctttgcgctcgacaaggtgctgcccgtc
gcggccggcatcggcggtggctcggcggatgcagcggcagcgctgcggctgctggcgcgt
ctcaacaacctgtcgctcgatgatccccgcctccagaaggtcgcgctcgcgaccggcgcc
gacgtgccggtgtgcctgtattcgcgcgcctgcgacatgaccggcgtcggcgagcagctg
ctgccgctcgcgctgccgagcatgccctgcgtgatggtcaatccgcgcgtgccggtcgcg
accaaggacgtgttccaggcgctgggcctgcgcaacggcgagctgctggtcggcgccacc
tccgtcatcggagccccggcctggccggaggagggcgcctcgattgccgactgggtcgag
gttctcgaaaccgtcgccaacgacctcgaagcccccgcgatgcgcatcgaacctgtcatc
ggcgaggtgctggaggcgctacgcgactccgccggcgtcaagctcgcccgcatgtccggc
tcgggcgcgacctgctttgcgatctatggcgcgccggccgaggcacatgctgccgcggaa
aagatccggcgcgatcaccccggctggtgggtgcatgcggggacgttgagctaa

DBGET integrated database retrieval system