KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2572Help
Entry
blr2572           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 1051523
NCBI-ProteinID: NP_769212
RhizoBase: blr2572
UniProt: Q89S33
Position
2814079..2814654
Genome map
AA seq 191 aa AA seqDB search
MSLDDIVAVRNDPIWALHHQIAVENLPDNKRPMSEQKFVQDPLESIRRVSGSLGNVVERL
GQIQRDSRLREATERWEVRLSALGIFEMVASEAGHAFGLPHLPEDPVSEHSLSRGMVPLV
AHAVVYLEGGGLKYEIKQPVFQGKIWAETAAKIAREVRSRLSFEGTEIAPTGDQLRPDQQ
GGGLEVKDRDD
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctggacgacatcgtggcagtccggaacgatccgatatgggcgttgcatcatcag
atcgctgtcgagaatctgccggacaacaagcggccgatgtcggagcagaagtttgttcag
gatcccctggagtccattcggcgcgtctccggttcgctgggcaacgtcgtcgagcgttta
ggccagatccagcgcgacagtcgcctccgcgaagccactgagcgttgggaggttcgactg
agtgcgctgggcattttcgaaatggtcgcctcggaagccggccacgcgtttggcttgcca
catctgcccgaggatccggtcagcgaacactcgctgtcgcgagggatggtgcctctcgtc
gctcacgcggtcgtctatctcgagggaggcgggttgaagtatgaaatcaagcagccggtc
tttcagggtaaaatctgggcggaaaccgccgcaaagatcgctcgggaggttcgtagccgg
ctgtcgttcgaggggaccgagattgcgccgacgggcgatcaattgcgtcccgaccagcag
ggcggcggacttgaggtcaaggatcgggacgattga

DBGET integrated database retrieval system