KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2576Help
Entry
blr2576           CDS       T00109                                 

Definition
(RefSeq) N-carbamyl-D-amino acid amidohydrolase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 1050176
NCBI-ProteinID: NP_769216
RhizoBase: blr2576
UniProt: Q89S29
Position
2816950..2817909
Genome map
AA seq 319 aa AA seqDB search
MARFVTIAAGQLGPIARAETRTEVVARLMALMRQARANGCDLIVYPELALTTFFPRWYFE
DQAEIDAFFEREMPGAQTQALFDLAREIGIGFYLGYAELTVEAGVARRYNTSILVDKSGA
IVAKYRKVHLPGHAEHEPWREFQHLEKRYFEPGSGFGVTNAFGGVMGMAICNDRRWSETY
RVMGLQGVEMVMIGYNTPVHNPPAPEHDDLSLFHNHLVMQAGAYQNGTFVVGVAKAGIEE
GVDHIGGSCIIAPSGEIVAACTTKGDEIALARCDLDLCNSYKRTTFNFDVHRQPRAYGMI
VERKGVTTMADGTQVPTKG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtggcgagatttgtgactatcgcggccggccagcttggcccgattgcccgagctgagacg
aggacggaggtcgtggcgcggctgatggcgttgatgcgccaggcgcgggccaacggctgc
gacctgatcgtctatcccgagctcgccctgaccacgttctttccgcgctggtatttcgag
gaccaggcggagatcgacgccttcttcgagcgcgagatgccgggggcgcagacgcaagcg
ctattcgacctcgcgcgcgagatcggtatcgggttttacctcggctatgccgagctgacg
gtcgaggccggcgtcgccaggcgctacaacacctccattctggtggacaagagcggcgcg
atcgtcgcgaaataccgcaaggttcatttgcccggccatgccgagcatgagccatggcgc
gaatttcagcatctggaaaagcgctacttcgagcccggcagcggctttggcgtgaccaat
gccttcggcggcgtgatgggaatggcgatctgcaacgaccgccgctggagcgagacctac
cgggtgatgggcctgcagggcgtcgagatggtgatgatcggctacaacacgccggtgcac
aatccgcctgcgcccgagcacgacgatctctcgctgttccacaatcacctggtgatgcag
gccggcgcctaccagaacggcaccttcgtggtcggcgtcgccaaggccggcatcgaggag
ggcgtcgaccacatcggcggcagctgcatcatcgcaccttcgggtgagatcgtcgcggcg
tgcacgaccaagggcgacgagatcgcgctggcgcgctgcgacctcgatctctgcaactcc
tacaagcgcaccaccttcaatttcgacgtccaccgccagccccgcgcctacgggatgatc
gtcgaacgcaagggcgtgacgacgatggcggatgggacacaagtgccgacgaaggggtga

DBGET integrated database retrieval system