KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2579Help
Entry
blr2579           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4118
Motif
Other DBs
NCBI-GeneID: 1048988
NCBI-ProteinID: NP_769219
RhizoBase: blr2579
UniProt: Q89S26
Position
2821092..2821511
Genome map
AA seq 139 aa AA seqDB search
MRRAGLFGVPWVRPWSWQAFLLGLVVVGLSAVFQGICVALGAKLYFAAFLPGLFVLGLVA
GAPAAAFAALLTIPLVWWAFMPPFFEFNALTSANTDSINLFCLLAVLLIGLADLCRETMT
IVNRGGLKRSGESAATNSQ
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgtgcggggctgtttggcgtaccgtgggtacggccatggtcgtggcaggcgttt
ctgctgggattggtcgtcgtcggactatcggcggtgtttcagggcatctgcgtcgcgctc
ggcgcaaaactctatttcgcggcgttcctgcctggcctgttcgtgctcggacttgtcgcg
ggcgcgccggcggcggcgttcgccgcgttgctcaccattccgctggtgtggtgggcgttc
atgccgcccttcttcgagttcaatgcgctgaccagcgcaaacaccgattccatcaacctg
ttctgcctcctcgccgtgctcctgatcggccttgccgatctctgccgggagacgatgacg
atcgtcaaccgcggcgggctgaagcgttcgggcgagagcgcggcaacgaattcgcaataa

DBGET integrated database retrieval system