KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2581Help
Entry
blr2581           CDS       T00109                                 

Gene name
cbbF
Definition
(RefSeq) fructose-1,6-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00010  Glycolysis / Gluconeogenesis
bja00030  Pentose phosphate pathway
bja00051  Fructose and mannose metabolism
bja00680  Methane metabolism
bja00710  Carbon fixation in photosynthetic organisms
bja01100  Metabolic pathways
bja01110  Biosynthesis of secondary metabolites
bja01120  Microbial metabolism in diverse environments
bja01130  Biosynthesis of antibiotics
bja01200  Carbon metabolism
Module
bja_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bja_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bja_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    blr2581 (cbbF)
   00030 Pentose phosphate pathway
    blr2581 (cbbF)
   00051 Fructose and mannose metabolism
    blr2581 (cbbF)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    blr2581 (cbbF)
   00680 Methane metabolism
    blr2581 (cbbF)
Enzymes [BR:bja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     blr2581 (cbbF)
Exosome [BR:bja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   blr2581 (cbbF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase TraY Auxin_canalis
Motif
Other DBs
NCBI-GeneID: 1049653
NCBI-ProteinID: NP_769221
RhizoBase: blr2581
UniProt: Q8GKS1
Position
2823214..2824251
Genome map
AA seq 345 aa AA seqDB search
MTGQLRLDDHLQRYSETAPHALAVATAVDAIAAAAIEIADLIGAGDLADASGLTTGRNSD
GDVQRDLDVQADAILRRCLGKLSIAALASEEMREPQIGDRAARICVAIDPLDGSSNIDIN
MTVGTIFSILPAPDDLALAFHQRGSAQFAAGFVTYGPQTSLVLTLGDGVDIFTLDRKAGC
FRLARSAIQISEAGEEFAINASNRRHWDPPVRAFIDECLAGVEGPANHDFNMRWVGSLVA
EAYRILTRGGVFLYPSDARPGYGDGRLRLTYEAHPMAYIIEQAGGSASTGRERILDLSAQ
SLHQRVPLIMGSSNEVRRVEELHCDPLLVASISAPLFARRGFFRL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggcaactcaggctggacgaccaccttcaacggtactcggagaccgcaccccac
gcgctggcggtggcgaccgcggtcgatgccatcgcggcggcggcgatcgagatcgccgac
ctcatcggcgccggcgatctcgcggacgcctcgggcctgaccacgggccgcaacagcgac
ggcgacgtccagcgcgatctcgacgtgcaggcggacgcgatcctgcgccgctgtctcggc
aagctgtcgatcgcagcgctggcgtcggaggagatgcgcgagccgcagatcggcgaccgc
gcggccaggatctgcgttgcgatcgatccgctcgacggctcctccaacatcgacatcaac
atgaccgtcggcacgatcttctcgattctgcccgcgcccgacgatctcgcgctcgccttc
catcagcgcggctcggcacagttcgcggcgggcttcgtcacctacggtccgcagacctcg
ctggtgctgacgctcggcgacggcgtcgacatcttcacgctcgaccgcaaggccggctgc
tttcgcctcgcgcgcagcgccatccagatctccgaggcgggcgaggagttcgcgatcaac
gcgtcgaatcgccggcattgggatcctccggtgcgtgccttcatcgacgaatgcctcgcc
ggcgtcgaaggccccgccaatcacgatttcaacatgcgctgggtcggttcgctggtcgcg
gaggcctatcgcatcctcacccgcggcggcgtgttcctctatccctcggacgcgcggccc
ggctatggcgacggccgcctgcgcctcacctacgaggcgcatccgatggcctacatcatc
gagcaggccggcggctcggcctcgaccggacgcgagcgcatcctcgacctgtcagcgcaa
agcctgcaccagcgcgtgccgctgatcatgggctcgagcaacgaggtgcggcgcgtcgag
gagctgcattgcgatccgctgctggttgccagcatctcagcgccgctgttcgcgcggcgc
ggcttcttccggctgtaa

DBGET integrated database retrieval system