KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2583Help
Entry
blr2583           CDS       T00109                                 

Gene name
cbbT
Definition
(RefSeq) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00030  Pentose phosphate pathway
bja00710  Carbon fixation in photosynthetic organisms
bja01100  Metabolic pathways
bja01110  Biosynthesis of secondary metabolites
bja01120  Microbial metabolism in diverse environments
bja01130  Biosynthesis of antibiotics
bja01200  Carbon metabolism
bja01230  Biosynthesis of amino acids
Module
bja_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
bja_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bja_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    blr2583 (cbbT)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    blr2583 (cbbT)
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    blr2583 (cbbT)
Enzymes [BR:bja01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     blr2583 (cbbT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C E1_dh DXP_synthase_N TPP_enzyme_C XFP_N
Motif
Other DBs
NCBI-GeneID: 1050155
NCBI-ProteinID: NP_769223
RhizoBase: blr2583
UniProt: H7C6U6
Position
2825156..2827174
Genome map
AA seq 672 aa AA seqDB search
MNISVHAEADVTAVAHNDLANAVRFLAVDAIETSQSGHPGLPMGMADVATVLFSRFLKFD
SAHPSWPDRDRFVLSAGHGSMLLYALLHLTGGAVSLDDIKAFRQWGSKTPGHPEYGHTPG
VETTTGPLGQGIATAVGMALAERMANARYGDGLVDHFTYVIAGDGCLMEGISQEAISLAG
HLRLGRLIVLFDDNGISIDGPTSLATSDDQLARFAASGWSVRRVDGHDPEAVAQAIAEER
ETAKPSLIACRTVIGYGAPDRQGTEKAHGAPLGTEQTAAARRTLGWDYQPFVVPIPILKA
WRMIGQRGQVERLAWLDRYESATPEQRDLFVEGKVVALPAAYALAAAKLRERFASERPKL
ATRQASQQVLDGIAGTIPGLVGGSADLTHSNLTHAKPQTPVTRGAFAGDYIHYGIREHGM
AAAMNGLALHGGFIPYGGTFLAFSDYSRPAIRLAALMRLRVIHVMTHDSIGLGEDGPTHQ
PVEHLAALRVIPNLLVFRPADAVETLEAWDCALAAEHRPSVLCLSRQALPTFRSDARGRN
RVARGAYLVVSPDGGRDVTLMATGSEVSIALEAARLLATEHIRAAVVSAPCLALFEEQPE
DYRATVLGTAPRVGIEAAVLGDWPRWIGADGEFVGMRGFGASAPAPVLYREFGITPQSIA
EAARRAIARKSQ
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaacatctccgtccatgccgaagccgacgttacggctgtcgcgcataacgatctcgcc
aacgccgtccgcttcctcgcggtcgatgccatcgagacatcgcagtccggccatcccggc
ctgccaatgggcatggccgatgtcgcgaccgtattgttctcgcgtttcctgaagttcgac
tcggcgcacccgagctggccggaccgcgatcgcttcgtgctttccgcgggccatggctca
atgctgctttatgcgctgctccatctcaccggcggcgctgtcagcctcgacgacatcaag
gcgttccggcagtggggctcgaagacgccgggccaccccgaatatggtcacacgccgggc
gtcgagaccacgacggggccactggggcaggggattgccactgccgtcggcatggcgctc
gccgagcgcatggccaatgcgcggtatggcgatgggctcgttgaccacttcacctatgtc
atcgcgggtgacggctgcctgatggaaggcatcagccaggaggcgatctcgcttgccggc
catctccggcttggccgcctgatcgtgctgttcgacgacaacggcatctccatcgacggg
ccgacgtcgcttgcgacatcggacgaccagctcgcgcgcttcgccgcctccggctggtcg
gtgcgccgcgtcgatgggcacgatcccgaagccgttgcgcaggcgatcgccgaagagcgc
gagaccgcaaaaccgtcgctgatcgcctgccgcaccgtcatcggttatggcgccccggac
cggcagggcaccgagaaggcccatggcgcgccgctcggcaccgagcagacggcggcggcg
cgccgaacgctcggctgggattatcagccgttcgtggtgccgatcccgatcctcaaggcg
tggcgcatgatcggacagcgcgggcaggtcgaacgtctcgcctggctcgatcgttacgag
agtgcgacgcccgagcagcgcgatttgttcgtcgaaggcaaggtcgtcgctctgccggcc
gcctatgcgctggccgcggcgaagttacgcgaacgctttgcgagcgagcggccgaagctc
gcgacgcggcaggcctcgcaacaggtgctcgacggcatcgccgggacaattccgggcctc
gtcggcggctcggcggacctgacccattcgaacctgacccatgccaagccgcagactccg
gtcacgcgcggcgcgttcgccggcgactatatccactacggcatccgcgagcacggcatg
gccgctgcgatgaacggcctcgcgctgcacggtggcttcattccctatggcggcacgttc
ctggcgttctccgactatagccggccggcgatccgccttgccgccttgatgcggctgcgc
gtcatccacgtgatgacgcacgactccatcggtctcggagaggacggcccgacgcaccag
ccggtcgagcatctcgccgcgctgcgcgtgatcccgaacctcctggtgttccgcccggcc
gacgcggtggagacgctcgaggcctgggactgcgccctagcggcggagcatcgtccctcc
gtgctctgcctgtcgcggcaagccttgccgacgttccgcagcgatgcgcgcggcagaaac
cgagttgcgcgcggtgcctatctcgtggtctcgccggacggcggccgcgatgtgacgctg
atggcgaccggctcggaagtctcgatcgcgctggaagccgcccgcctgctcgcgaccgag
cacattcgcgcggccgtcgtctcggcgccctgcctcgcgctgttcgaggagcagccggag
gattatcgcgccaccgtgctcggcaccgcgccgcgtgtcgggatcgaggcggccgtgctc
ggcgactggccgcgctggatcggcgccgacggtgaattcgtcggcatgcgcggcttcggc
gcctcggcgccggcgccggtgctgtatcgcgaattcggcatcaccccgcaaagcattgcg
gaagccgcccgccgggcgatcgcccgcaagagccaataa

DBGET integrated database retrieval system