KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2592Help
Entry
blr2592           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 1049411
NCBI-ProteinID: NP_769232
RhizoBase: blr2592
UniProt: Q89S20
Position
2837376..2837900
Genome map
AA seq 174 aa AA seqDB search
MTGSSEKAAFARQSSKSRVALAAMKTPRRAARVELRTSGRFVEPAGGSYLIGADMDRLKL
SLRCALLVAPLVLSAGSALGRDDGRYADSPLKPWFDSLRSHLGPCCSDADGFAVSDPDWE
SHDGHYRVRLDGQWVDVPDEAVITEPNRAGRTMVWPVKTAFGISIRCFMPGSMI
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggttcgtccgaaaaagccgcgttcgctcgtcagagttcgaaatcgcgtgtcgcc
ttggcggcaatgaagacgccaaggcgagctgctagagtggaacttcggacgtccggccgt
tttgtggaaccggccggcggttcgtatttgatcggtgccgacatggatcgattgaagctc
tcgctgagatgtgcgctgctcgtggcgccgctcgtactgtcggctggaagcgccctgggg
cgtgatgacggccgctacgccgattcgccgctcaagccctggttcgacagtctgcgcagc
catctcggcccgtgctgctcggatgccgacggatttgccgtctccgatcccgattgggaa
tcgcatgacgggcactatcgcgtccgcctcgatgggcagtgggtcgatgtgcccgatgaa
gccgtcatcaccgagccgaaccgcgccggtcgcaccatggtgtggccggtgaagaccgcg
tttggcatctcgatccgctgcttcatgccgggcagcatgatctag

DBGET integrated database retrieval system