KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2614Help
Entry
blr2614           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger TrkA_N
Motif
Other DBs
NCBI-GeneID: 1051052
NCBI-ProteinID: NP_769254
RhizoBase: blr2614
UniProt: Q89RZ8
Position
2860785..2862515
Genome map
AA seq 576 aa AA seqDB search
MHELIRDITLCILFAWMLGLLAHFSRQPLILAYLIAGFCIGPFGAGWVKSQESISVISEL
GLIFMLFMIGLEIDLKKIVRAGKVILFAAGGQLPGGCLLGVLFFAGIGLSLGGGHFDAVY
LCIACALSSTVIIVKVLYEKRELDTLPGRITLGVLVLQDIFAILFLAVQPSLANLQVSVI
LLSIGRVAVLVAAALLVSRYVLPRLFHQIARRPELILLGALAWCFLVAETAERLSLSREM
GALIAGVSLSTFPYALDVTAKVTTLRDFFITLFFVALGMTIPVPGLSVIGLALMIAAFTV
VSRLVTTFTPLYLMKQGLRASLLPALNLAQISEFSLVVIQTGVTDNHIAAETANAASFAF
VVLAVLSTFVMTRSDEIARWAIGPLKRIGLRDLDHGNGHAEEGHEGGHGEARRIVILGFF
RAASALLAEIERQAPVLLEQITVVDFNPNVYQTLLSRGLHVIYGDISSADTLLHAGVGKS
EMIILSVPDALLKGASNEKLVRHVRTLNPTAMIVATADLLSDVGELYEAGASYVTVTRLS
DAHELFTVIEAAQAGLLADKRAELDLRLGERREVLP
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgcatgagcttattcgcgacatcactctctgtatcctgtttgcctggatgctgggcctg
ctcgcccatttctcccggcaaccgctgatcctggcctaccttatcgccggcttctgcata
ggtccattcggcgccggctgggtcaaatcgcaggaatcgatcagcgtcatctccgagctt
ggcctgatcttcatgctgttcatgatcgggctggagatcgacctgaagaagatcgtgcgg
gcgggaaaggtgatcctgtttgcggcgggcggccagctgcccggcggctgcctgctcggg
gtcctgtttttcgccggcatcggcctgtcgctcggcggcgggcatttcgatgcggtctat
ctctgtatcgcctgcgcgctgtcgagcaccgtcatcatcgtcaaggtgctctacgagaag
cgcgagctcgacacgctgcccggccgcatcacgctcggcgtgctggtgctccaggacatc
ttcgccatcctgttcctggcggtgcagccgagtcttgccaatctgcaagtgagcgtcatc
ctgctctcgatcggccgcgtcgcggtgctggtcgccgccgcgctgctggtcagccgctat
gtgctgccgcgcctgttccaccagatcgcccgccggcccgaactgatcctgctcggcgcg
ctcgcctggtgcttcctcgtggccgagaccgcggagcggctgtcgctgtcgcgcgagatg
ggcgccctgatcgccggcgtctcgctttcgacctttccctatgcgctcgacgtcaccgcc
aaggtcaccacgctgcgcgacttcttcatcacgctattcttcgtcgcgctcggcatgacc
attcccgtgcccggcctctccgtgatcgggcttgccttgatgatcgcggcgttcacggtg
gtgagccggctcgtcacgaccttcacgccgctctacctgatgaagcaggggctgcgtgcc
agcctgttgccggccctgaacctcgcgcagatctccgagttctcgctggtcgtgatccag
accggcgtcaccgacaaccacatcgcagccgaaacggcgaacgcggcctccttcgccttc
gtggtgctggccgtgctctcgactttcgtgatgacgcgcagcgacgagatcgcccgctgg
gcgatcggcccgttgaagcggatcggcctgcgcgatctcgatcacggcaacggccatgcc
gaggagggccacgagggcggccatggcgaggcccgccgcatcgtcatcctgggctttttc
cgcgcggctagcgcgctgctggccgagatcgaacggcaggcgccggtgttgctcgagcag
atcacggtggtcgatttcaaccccaatgtgtaccagaccctgctttcacgcggtctgcac
gtgatctatggcgacatcagcagcgcggacacgctgctccatgccggcgtcggcaagtcc
gagatgatcatcctcagcgtgccggatgcgcttctcaagggcgccagcaacgagaagctg
gtccgccacgtccgcaccctcaacccgaccgccatgatcgtggctacggccgatcttttg
tcggatgtcggcgagctctacgaggccggtgccagttacgtcaccgtgacccgactcagc
gacgcccacgagctgtttaccgtgatcgaggccgcccaggccggcctgctcgcggataag
cgcgccgagctcgacctgcggctcggcgagcggagagaggtgctgccctga

DBGET integrated database retrieval system