KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2616Help
Entry
blr2616           CDS       T00109                                 

Gene name
gcdH
Definition
(RefSeq) glutaryl-CoA dehydrogenase
  KO
K00252  glutaryl-CoA dehydrogenase [EC:1.3.8.6]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00071  Fatty acid degradation
bja00310  Lysine degradation
bja00362  Benzoate degradation
bja00380  Tryptophan metabolism
bja01100  Metabolic pathways
bja01120  Microbial metabolism in diverse environments
bja01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    blr2616 (gcdH)
  Amino acid metabolism
   00310 Lysine degradation
    blr2616 (gcdH)
   00380 Tryptophan metabolism
    blr2616 (gcdH)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    blr2616 (gcdH)
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.6  glutaryl-CoA dehydrogenase (ETF)
     blr2616 (gcdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 1049070
NCBI-ProteinID: NP_769256
RhizoBase: blr2616
UniProt: Q89RZ6
Position
2863901..2865115
Genome map
AA seq 404 aa AA seqDB search
MSVRPQTKDKPAAASFQWDDPFLLDEQLTEDERMVRDTARAYAQDKLLPRITKAYLEETT
DREIFNEMGELGLIGITLPEEYGCANASYVAYGLVAREIERVDSGYRSMNSVQSSLVMYP
IYAYGDENQRKKYLPKLASGEWVGCFGLTEPDAGSDPAGMKTRAEKVSDGYRLTGSKMWI
SNAPIADVFVVWAKSAAHDNQIRGFVLEKGMKGLSAPKIGGKLSLRASITGEVVMDGVVV
PEDALLPNVSGLKGPFGCLNRARYGISWGALGAAEDCMHRARQYTLDRKQFGKPLAATQL
VQKKLADMETEIALGLQGSLRVGRLMDEGKFAPEMISIMKRNNCGKALDIARVARDMHGG
NGISIEYHVMRHVHNLETVNTYEGTHDVHALILGRAITGIQAFF
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcgccctcagaccaaggacaagccggctgcggcttctttccagtgggacgat
ccgttcctgctcgacgagcagcttaccgaagacgagcgcatggtgcgcgacaccgcgcgc
gcctacgcccaggacaagctgctgccgcgtatcaccaaggcctatctcgaagagacgacg
gatcgcgagatcttcaacgagatgggcgaactcggcctgatcggcatcacgctgcccgag
gaatatggctgcgccaatgcgagctacgtcgcctacggcctggtcgcgcgggagatcgag
cgggtcgattccggctatcgttcgatgaactcggtgcagtcctcgctggtgatgtacccg
atctacgcctatggcgacgagaaccagcgcaagaaatacctgccgaagctcgccagcggc
gagtgggtcggctgcttcggcctgaccgagcccgatgccggctccgatccggccgggatg
aagacccgcgccgagaaggtctcggacggctaccgcctgaccggcagcaagatgtggatc
tcgaacgcgccgatcgccgacgtgttcgtggtctgggccaagtcggccgcgcatgacaac
cagatccggggcttcgtgctggagaagggcatgaagggcctctccgcgccgaagatcggc
ggcaagctcagcttgcgcgcctccatcaccggcgaagtcgtgatggacggtgtcgtggtt
ccggaagacgcgctgctgcccaacgtctccggcctcaagggcccgtttggctgcctcaac
cgcgcccgctacggcatttcctggggcgcgctgggcgcggccgaggactgcatgcaccgc
gcccgccagtacacgctcgaccgcaagcagttcggcaagccgctggccgcgacccagctc
gtccagaagaagctcgctgacatggagaccgagatcgcgctcggcctccagggctcgctt
cgcgtcggccgcctgatggacgagggcaagttcgcccccgagatgatctcgatcatgaag
cgcaacaattgcggcaaggcgctcgacatcgcccgcgtcgcgcgcgacatgcacggcggc
aacgggatctcgatcgagtaccacgtgatgcgccacgtccataacctcgagacggtcaac
acctacgagggcacccacgacgtccacgccctgatcctgggccgcgccatcacgggcatt
caggcgtttttctag

DBGET integrated database retrieval system