KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2626Help
Entry
blr2626           CDS       T00109                                 

Gene name
dnaJ
Definition
(RefSeq) chaperone protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaJ_C DnaJ
Motif
Other DBs
NCBI-GeneID: 1048922
NCBI-ProteinID: NP_769266
RhizoBase: blr2626
UniProt: Q89RY6
Position
2874743..2875705
Genome map
AA seq 320 aa AA seqDB search
MRDPYEVLGVPRSANAAAIKSAYRKLAKKHHPDSNKDDPKAAERFAELNSANEILGDEDK
RKQFDRGEIDADGKPRFQGFPGGGGPRGRAGPGGFESYTFRSGGGPGQGGGAFEDILNSM
FGGGVRGARPGAGGAGQFEFDTGGIGLDLDVNVAMSVSLEESVKGGEKRVRLPTGKELNV
KIPAGVTEGQQIRLRGQGESAQGHPPGDLLITIGIAPHPYFKVEGADLRIDLPVTLYEAV
LGGKVRVPTLGNAVELSVPKNTSSGRTFRLKGKGLPKAGGTGDLFVTVRIMLPDGNDAEL
EALMEKWRDQHPYNPRSGLG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgacccctatgaggtcttgggggtgccgcggagcgccaatgctgccgcgatcaag
agcgcctatcgcaagcttgccaagaagcaccatcccgacagcaacaaggacgacccgaag
gccgccgagcgtttcgccgaactcaattcggccaacgagatcctcggcgacgaggacaag
cgcaagcagttcgaccgcggcgagatcgacgccgacggcaagccgcgcttccagggcttt
ccgggcggcggcgggccgcgcggccgcgcgggtcccggcgggttcgagagctatacgttc
cgctccggcggcggcccgggtcagggcggcggcgcgttcgaggacatcctcaacagcatg
ttcggcggcggggtgcgcggcgcgcggccgggggccggcggcgccgggcagttcgaattc
gacaccggcgggatcgggctcgatctcgacgtgaacgtcgccatgtccgtctcgctagag
gagtcggtcaagggcggcgagaagcgcgtccgtctgccgacgggcaaggagctcaacgtc
aagattccggccggcgtcaccgagggccagcagatccggctgcgcgggcagggcgagagc
gcccagggccatccgccgggcgatcttctgatcaccatcggcatcgcgccgcacccgtat
ttcaaggtcgagggcgcggatctcaggatcgacctgccggtcacgctctacgaggcggtg
ctcggcggcaaggtccgcgtgccgacccttgggaatgcggtcgaactctcggtcccgaag
aacacttccagcggccgcaccttccggctgaagggcaagggcctgccgaaagcaggcgga
accggggatctcttcgtcactgtcaggattatgctaccggacgggaacgacgccgagctt
gaagcattgatggagaagtggcgggaccaacacccctacaatccacgtagcgggcttggt
tag

DBGET integrated database retrieval system