KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2696Help
Entry
blr2696           CDS       T00109                                 

Definition
cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     blr2696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2953744..2954727
Genome map
AA seq 327 aa AA seqDB search
MRRLTGFRGAGPGAGYRGGLIAICAVLLCCVEVTPAPSQPPSAHAFDRGEPITPIPAAPA
ADPLKVALGEKLFGDRRVSHDNSRACQSCHDIATNGASQKRHDVGLNGAELALNTLTVFN
STLSFRFGWEGKFRTLEADIEASLQSQHTMGSSAAEVAAKLDADPDMRDRFVAAYGRRPE
GADVVDALASFQRTLVTPGSRFDRWLKGDDAALLAGELDGYRLFKSLGCSACHQGVNVGG
NLFERHGIFHPLASPEPRILRVPSLRNVATTAPYFHDGSAPTLDDAVRKMALAQLNATLT
DQQVKALVAFLNSLTGTYRGAPVGGSP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgcgacgattgactggatttcgcggagccggaccaggcgccggctatcggggtggcttg
atcgccatttgcgcggtgctgctgtgctgcgtggaagtcacgcccgcgccgtcgcagccg
ccgtcggcgcacgcatttgaccgcggggagccgatcacgccaattcccgcggcccctgcc
gccgacccgctcaaggtcgcccttggcgagaagctgtttggcgatcgccgggtctcgcat
gacaattcccgcgcctgccaatcttgtcacgatatcgcgacgaacggcgcgagccagaag
cggcacgatgtcggcctcaacggggcggagcttgcgctcaacacgctcaccgtcttcaat
tcgacgctcagctttcgtttcggctgggaaggaaaattccgtaccctcgaggccgatatc
gaggcatcgctgcaaagccagcacaccatgggcagcagcgcggcggaggttgccgcaaag
ctcgatgccgatcccgacatgcgcgatcgtttcgtcgcggcctatggccgccgtccggaa
ggcgccgatgtcgtcgacgcgctggcgagctttcaacgcacgctggtcacgccgggcagc
aggttcgatcgctggctgaagggcgacgacgcagcccttttggccggcgagctggacgga
taccgcctgttcaaatcgctgggttgctccgcctgccatcagggcgtcaacgtcggcggc
aatctgttcgagcggcacggcatattccatcccctcgcgtcgcccgagcccaggatcctg
cgcgtgccgagcctgcgcaacgtcgcgacgaccgcgccgtattttcatgacggcagcgcg
ccgacgctcgatgacgcggttcgcaagatggcgctggcccagttgaacgcgacgctgaca
gaccagcaggtcaaggcgctcgtcgcctttctcaacagcttgaccgggacctatcgcggc
gcgcccgtcggaggctcgccgtga

DBGET integrated database retrieval system