KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2728Help
Entry
blr2728           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2998612..3000171
Genome map
AA seq 519 aa AA seqDB search
MDMRGMTVAVGPDEDRVVARGTPRRACRQSLLGICTAAVLAPLAVLLDASSAQAQFVCVN
ASNSADGASASSIQSVACGTNSSATTGGSAFGESSSAGPEAAAFGAGSLASGGLSTALGY
RSTASGFFSTAAGSASAATGALTSAFGYQSSASGYTATAVGYRAGAGGDGSTALGYATVA
GGNASTAAGNSSRADAENALAVGTNANVYAAGTNGTAVGYNIGVNGANSTAVGASNAISG
DNSGAFGTVQIVRGDRSFTLGGNNTINGTSQAGWGNVVNVVGSNNTVAGTASAAGSSVFG
TGNAVNAPNALVMANTATVAGSGGIAIGNTVSVAGVNAVAVGNNTSAGFANSAAIGNGAA
ATRANQQAFGTAGNTYTMAGIASSASKSAQSGATQLVTSDGAGNLATTTLASLGLASSSD
LSAVNAQLASINGRLDDLSMRTSKATSGVAMAFAMAGVPTLLPDETFAMTMNYGTFERAN
GLAFNAALRLNRNMQFNGGIGYGPDEKVAGGRVGLRVGW
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggatatgcgggggatgacggtcgcggtggggccggacgaggatcgggttgtcgcgagg
gggacgccgcgccgtgcgtgcaggcagtccttgctcggaatttgcaccgccgcggtgctt
gcccccttggccgtcctgctggatgcgtcgtcggcgcaggcgcagttcgtttgcgtcaat
gccagcaacagtgcggacggtgcgagcgcgagctcgatacaaagcgtggcttgcggtacc
aattcttccgcgaccacgggtggctccgcattcggcgaatcgagctctgccggtcccgag
gccgcggcctttggcgccggcagtctggcctctggcggcctcagcacagcgctgggctat
cgaagcactgccagcggcttcttcagcacggcggctggtagcgccagcgcggccaccggc
gccctgacctcggcatttggctaccaaagctccgcgagcggttacaccgccacggccgtg
ggctatcgggcaggcgcaggtggtgacggcagcacggctcttggctacgcgacagtcgca
ggcggcaacgccagcacggccgcgggcaattccagtcgcgcggacgccgaaaatgcgctt
gcagtgggtacaaacgcgaacgtctatgctgccggcaccaacggcacggccgtcggttac
aatatcggcgtgaacggcgccaatagcaccgcggtcggcgctagcaacgcgatctccggc
gacaacagcggtgcgttcggcaccgtgcagatcgtccgaggcgaccgcagcttcacactg
ggcggcaacaacacgatcaacggcaccagccaggccggctggggcaacgtcgtcaacgtg
gtcggctccaacaacaccgtggccggcaccgcgagcgcggccggctcctcggtgttcggc
accggcaacgccgtcaacgcacccaatgcgctggtgatggcgaacacggcgaccgtggcc
gggtcaggcggcatcgcgatcggcaacaccgtatcggtcgcgggcgtcaacgccgtcgcc
gtcggcaacaacaccagcgccggcttcgccaactccgccgcgatcggcaacggtgccgca
gcgacgcgtgccaatcagcaggcgttcggcacggcaggcaacacctacaccatggccggc
atcgcctcgtcggccagcaagtccgcgcaaagcggcgcgacgcagcttgtcacgtccgac
ggcgccggcaatcttgcgaccactacgctcgccagtctcggcctggcctcgtcgagcgat
ctcagcgccgtcaatgcgcagctcgccagcatcaacggtcgcctcgacgacctcagcatg
cggaccagcaaggcgaccagcggcgtcgccatggcctttgccatggccggcgtgccgacg
ctgctgccggacgagacctttgccatgacgatgaactacgggaccttcgagcgggccaac
ggtcttgcgttcaatgcggcgctgcgcctcaatcggaacatgcagttcaacggtggcatc
ggctacgggccggacgagaaggtcgccggcggacgcgtgggcctgcgcgtgggctggtga

DBGET integrated database retrieval system