KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2882Help
Entry
blr2882           CDS       T00109                                 

Definition
bifunctional P-450:NADPH-P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    blr2882
  Amino acid metabolism
   00380 Tryptophan metabolism
    blr2882
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    blr2882
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     blr2882
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     blr2882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3173438..3176674
Genome map
AA seq 1078 aa AA seqDB search
MSSKNRLDPIPQPPTKPVVGNMLSLDSAAPVQHLTRLAKELGPIFWLDMMGSPIVVVSGH
DLVDELSDEKRFDKTVRGALRRVRAVGGDGLFTADTREPNWSKAHNILLQPFGNRAMQSY
HPSMVDIAEQLVQKWERLNADDEIDVVHDMTALTLDTIGLCGFDYRFNSFYRRDYHPFVE
SLVRSLETIMMTRGLPFEQIWMQKRRKTLAEDVAFMNKMVDEIIAERRKSAEGIDDKKDM
LAAMMTGVDRSTGEQLDDVNIRYQINTFLIAGHETTSGLLSYTLYALLKHPDILKKAYDE
VDRVFGPDVNAKPTYQQVTQLTYITQILKEALRLWPPAPAYGISPLADETIGGGKYKLRK
GTFITILVTALHRDPSVWGPNPDAFDPENFSREAEAKRPINAWKPFGNGQRACIGRGFAM
HEAALALGMILQRFKLIDHQRYQMHLKETLTMKPEGFKIKVRPRADRERGAYGGPVAAVS
SAPRAPRQPTARPGHNTPMLVLYGSNLGTAEELATRMADLAEINGFAVHLGALDEYVGKL
PQEGGVLIICASYNGAPPDNATQFVKWLGSDLPKDAFANVRYAVFGCGNSDWAATYQSVP
RFIDEQLSGHGARAVYPRGEGDARSDLDGQFQKWFPAAAQVATKEFGIDWNFTRTAEDDP
LYAIEPVAVTAVNTIVAQGGAVAMKVLVNDELQNKSGSNPSERSTRHIEVQLPSNITYRV
GDHLSVVPRNDPTLVDSVARRFGFLPADQIRLQVAEGRRAQLPVGEAVSVGRLLSEFVEL
QQVATRKQIQIMAEHTRCPVTKPKLLAFVGEEAEPAERYRTEILAMRKSVYDLLLEYPAC
ELPFHVYLEMLSLLAPRYYSISSSPSVDPARCSITVGVVEGPAASGRGVYKGICSNYLAN
RRASDAIYATVRETKAGFRLPDDSSVPIIMIGPGTGLAPFRGFLQERAARKAKGASLGPA
MLFFGCRHPDQDFLYADELKALAASGVTELFTAFSRADGPKTYVQHVLAAQKDKVWPLIE
QGAIIYVCGDGGQMEPDVKAALVAIRHEKSGSDTATAARWIEEMGATNRYVLDVWAGG
NT seq 3237 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccaagaaccgtctggacccgatcccgcagccgccgaccaagccggtggtcggc
aatatgctgtcgctggactcggcggctcccgtgcagcacctgacgcggctcgccaaggag
ctcggcccgatcttctggctcgacatgatgggctcgccgatcgtcgtcgtctcgggccac
gatctcgtcgacgagctgtccgacgagaagcgcttcgacaagacggtgcgcggcgcgctg
cggcgcgtgcgtgcggtcggcggcgacggcctgttcacggccgacaccagggagccgaac
tggagcaaggcgcacaacatcctgctccagccgttcggcaaccgcgcgatgcagtcctac
cacccgagcatggtcgacatcgccgagcagctcgtccaaaaatgggagcggctcaacgcc
gacgacgagatcgacgtcgtccacgacatgaccgccctgacgctggacacgatcggcctg
tgcggcttcgactaccgattcaattcgttctaccggcgcgactaccatcccttcgtcgag
tcgctggtgcgctcgctcgaaaccatcatgatgacgcggggtcttccgttcgagcagata
tggatgcagaagcggcgcaagaccctcgctgaagacgtcgccttcatgaacaagatggtt
gacgagatcatcgcggagcgccgcaagagcgcggaggggatcgacgacaagaaggacatg
ctcgcggcgatgatgaccggcgtcgaccgctcgaccggcgagcagctcgacgacgtcaac
atccgctaccagatcaacacgtttttgatcgccggccacgagacgacaagcggcctgttg
tcctacacgctctatgcgctcctgaagcatcccgacatcctcaagaaggcctatgacgag
gtcgatcgcgtcttcggtccagatgtcaacgcgaagccgacctatcagcaggtgacgcag
ctcacctacatcacgcagatcctgaaggaggcgttgcggctgtggccgccggcgccggcc
tacggcatctcaccgctcgcggacgaaaccatcggtggcggcaagtacaagctcaggaaa
ggcacgttcatcaccattctggtgacggcgctgcatcgcgatccctccgtctgggggccg
aatcccgatgccttcgatcccgaaaatttcagccgcgaggcggaggccaagcggcccatc
aatgcctggaagccgttcggcaacggtcagcgcgcctgcatcggccgcggctttgccatg
cacgaggcggcgctcgcgctcggcatgatcctccagcgtttcaagctgatcgaccaccag
cgctaccagatgcacctgaaggaaacgctgacgatgaagccggagggcttcaagatcaag
gttcgtccgcgcgccgatcgcgagcgcggtgcctatggcgggcctgtcgcggctgtgtcc
tcggcgccgcgagcaccgcgtcagccgacggcgcggcccggccacaacacgccgatgctg
gtgctgtacggctccaatctcggcaccgccgaagaactcgcgacacgcatggccgacctc
gccgagatcaacggctttgccgtgcatctcggggcgctcgacgaatacgtcggcaagctg
ccgcaggagggcggcgtgctgatcatctgcgcctcctataacggagcgccgccggacaat
gcgacgcaattcgtcaaatggctcggcagcgacctgcccaaggatgcctttgccaatgtg
cgctacgccgtgttcggctgcggcaacagcgactgggctgcgacctatcaatcggtgccg
cgcttcatcgacgagcaattgtcggggcatggcgcgcgcgcggtctatccgcgcggcgaa
ggcgacgcgcgcagcgatctcgacggccagttccagaagtggtttccggcagccgcgcag
gtcgcgaccaaggagttcggcatcgactggaattttacccgcaccgcggaggacgatccg
ctctacgcgatcgaacctgtcgcggtgactgccgtcaataccatcgtcgcacagggcggc
gcggtggcgatgaaggtgctggtcaatgacgagcttcagaacaagagcgggtccaatccg
tcggagcgctcgacgcgccatatcgaggtgcagctgccatccaacatcacctaccgcgtc
ggcgatcatctgagcgtcgttccgcgcaacgatccgacgctggtggattcggtcgcccgc
cgcttcggcttcctgccggccgaccagatcaggcttcaggtggccgaaggccgccgtgcg
caattgccggtcggcgaggccgtgtcggtcggccgcctgctcagcgagttcgtcgagctg
cagcaggtggcgacgcggaagcagatccagatcatggccgagcacacgcgctgcccggtc
accaagccgaagctgctggccttcgtcggcgaggaggccgagccggccgagcgctatcgc
accgagattctggcgatgcgcaaatcggtgtacgatctgctgctcgaatatccggcctgc
gaattgccgttccacgtttatctggaaatgctctcgctgctggcgccgcgctactactcg
atctcctcttccccgtcggtcgatccagcgcggtgcagtatcacggtcggcgtcgtcgag
gggccggccgcttccgggcgcggcgtctacaaaggcatctgctcgaactatctcgccaac
cggcgcgcgagcgatgcgatctacgccacggtgcgcgagaccaaggccggcttccggctc
ccggacgattcatccgtgccgatcatcatgatcggcccgggcacggggctggcgccgttc
cgcggcttcctccaggagcgcgccgcgcgcaaggcgaaaggcgcttcgcttggcccggcc
atgctgttcttcggctgccgtcaccccgatcaggattttctctacgccgacgagctgaag
gcgctggcggcaagcggcgtcaccgagctcttcaccgcgttctcgcgcgcggacggaccg
aagacctatgtgcagcacgtgctcgcggcgcagaaggacaaggtctggccactgatcgag
cagggcgccatcatctacgtctgcggcgacgggggccaaatggagcccgacgtgaaggcg
gcccttgtcgcgatccgtcacgagaagagcggtagcgataccgcgacagccgcgcgctgg
atcgaggagatgggcgcgacgaaccgctatgtgctcgacgtctgggcgggcggttag

  All links  
No link information was found.   
DBGET integrated database retrieval system