KEGG   Bradyrhizobium diazoefficiens USDA 110: blr3127Help
Entry
blr3127           CDS       T00109                                 

Gene name
cycK
Definition
(RefSeq) cytochrome C-type biogenesis protein
  KO
K02198  
cytochrome c-type biogenesis protein CcmF
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
Transporters [BR:bja02000]
 Other Transporters
  Others
   blr3127 (cycK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3451702..3453684
Genome map
AA seq 660 aa AA seqDB search
MIAESGHYALVLALGLALIQSIVPLIGARLRDDALMSVARSTALAQLLFVGASFVALVML
HVNSDFSVANVYENSHSMKPLLYKITGVWGNHEGSMLLWVSILALFGGLVAAFGNNLPLS
LRAHVLAVQAWIASAFYLFILVTSNPFLRIANPPIEGRDLNPVLQDIGLAVHPPMLYLGY
VGFSISFSFAIAALMEGRIDAAWARWVRPWTLVAWIFLTLGIAMGSYWAYYELGWGGWWF
WDPVENASLMPWLAGTALLHSALVMEKRNALKVWTILLSILTFSLSLLGTFLVRSGVITS
VHAFATDPTRGVFILLILCLFIGGSLSLFAGRATSLKQGGLFAPISREGALVLNNLLLTV
ACAVVLFGTLYPLAMEMLADFKMSVGAPFYNLTFAPLFALLLLAVPFGPMLAWKRGDLLG
VTQRLLAAGVAGLVVVAIVWAWTRGGSALAPLAIGLGVFVIAGAVTDLVERTGLVRLPLA
TALQRARGLPRSAWGAALAHAGLGVALIGIVCETTWNSEYIATMKRSDVAHVAGYDVKLD
GLFQRQGPNYREMIAEFNVSRDGETLSVMTPSKRSFTTRGSSTTEAALLTRGASQLYISL
GDANAEGAIAVRIYHKPLVLLIWWGPVLMAFGGVLSLSDRRLRVGAPKPARAKQRLQPAE
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcggaatccgggcattacgcgctggtgctggcgctcgggctggcactgatccaa
tccatcgtgccgttgatcggcgcgcggctgcgcgacgatgcgctgatgagcgtggcgcgc
tccaccgcgctggcgcagctgctgttcgtcggcgcctcgttcgtggcgctggtgatgctg
catgtgaattcggatttctccgtcgccaacgtctacgagaattcgcattcgatgaagccg
ctgctctacaagatcaccggcgtctggggaaaccatgaaggctcgatgctgctgtgggtg
tcgatcctggcgctgttcggcggattggtcgcggcgttcggcaacaatcttccgctgtcg
ctgcgcgcgcatgtgctcgcggtgcaggcctggatcgccagtgccttctatctcttcatc
ctggtgacctcgaacccgttcctgcgtatcgccaacccgccgatcgagggacgcgatctc
aatcccgtgctgcaggacatcggtctcgccgtgcatccgccgatgctctatctcggctat
gtcggattctcgatctcgttctcctttgccatcgcggcgctgatggaggggcggatcgac
gccgcctgggcgcgctgggtgcggccgtggacgctggtcgcgtggatcttcctgacgctc
ggcatcgcgatgggctcctactgggcctattacgagctcggctggggcggctggtggttc
tgggatccggtcgagaacgcctcgctgatgccgtggcttgccgggacggcgctgctccat
tcggcgctggtgatggagaagcgcaacgcgctgaaggtctggaccatcctgctgtcgatc
ctgaccttctcgctatcgctgctcggcaccttcctggtgcgctcgggcgtcatcacctcc
gtgcatgcctttgccaccgatccgacccgcggcgtgttcattctgctgatcctctgcctg
ttcatcggcggcagcctgtcgctgttcgcaggccgcgcgacatcgttgaagcagggcggc
ctgttcgcgccgatctcgcgtgagggcgcgctggtgctgaacaatctgctgctgaccgtc
gcctgcgcggtcgtgctgttcggcacgctctatccgctggcgatggagatgctcgccgac
ttcaagatgtcggttggcgcgccgttctacaacctcaccttcgcaccgctgtttgccctg
ttgctgctcgccgtgccgttcgggccgatgctggcgtggaagcgcggcgatctgctcggc
gtcacccagcggctgctcgcggccggcgttgccgggctcgttgtagtcgcgatcgtctgg
gcctggacgcgtggcggcagcgcgctcgcaccgctcgcgatcggacttggcgtcttcgtc
atcgccggcgccgtcaccgatctggtcgagcggacgggcctggttcgtctgccgctcgca
acagcgctgcagcgggcgcgcggcctgccacgctcggcctggggcgcggcattggcgcat
gccggcctcggcgtcgcgctgatcgggatcgtctgcgagaccacctggaacagcgaatat
atcgcgacgatgaagcggagcgacgtcgcccatgtcgccggctacgacgtgaagctcgac
gggttgtttcagcgtcagggcccgaactaccgcgagatgatcgccgagttcaacgtcagc
cgcgacggtgagacactgagcgtcatgacgccgtccaagcgcagcttcaccacccgcggc
tcctccaccacggaggccgcgctgctgacccgcggggcgagccagctctacatctcgctg
ggcgatgccaatgccgagggcgcgattgccgtgcgcatctatcacaagccgctggtgctg
ctgatctggtggggtccggtgctgatggccttcggcggcgtgctgtcgctgtccgatcgc
cgcctgcgggtcggcgcgccaaaaccggcgcgggccaagcagcgcctgcagccggcggag
tga

DBGET integrated database retrieval system