KEGG   Bradyrhizobium diazoefficiens USDA 110: blr3206Help
Entry
blr3206           CDS       T00109                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    blr3206
   00052 Galactose metabolism
    blr3206
Enzymes [BR:bja01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     blr3206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3544386..3545462
Genome map
AA seq 358 aa AA seqDB search
MAGSKITKDVFGTLPDGRNVERIVLRGEGGFEARIITHGAVIQALIAPDAKGGYDDVVLG
HDAFAGYLAERKFLGATVGRYANRIARGQFSLDGETVQLPVNNGPNALHGGLDGFDRKLW
AIAGIEEGAEPAVTLTYTSPHGEENYPGRLDVRLTYRVTGPAELSLMMEARTDRPTIVNL
TNHSFFNLEGATSGTSILDHRLTVAAEHFLAIDPTAIPLPEPPRAVAGTPFDFRNPHAVG
ERIRENDRQLQSGRGYDHTYCLGRDGKLALAARLEAPRSGRIMELFTNQPGIQVYSGNYL
DGTISGKGGKLIRQSDAMCLEPHIWPDAPNRPDFPSPRLDPGQVYRHHTVYRFAVRAP
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggctggctcaaaaataacaaaagacgtcttcggaacgctgccggacggccgcaatgtc
gagcgcatcgtgctgcgcggcgagggcggctttgaagcccgtatcatcacccatggcgcg
gtgatccaggcgctgatcgcgccggacgccaagggcggctacgacgatgtcgtgctcggc
cacgacgccttcgccggctatctcgccgaacgaaaattcctgggcgccaccgtcggccgc
tacgccaaccgtatcgccaggggacagttctcgctcgacggcgagacggtgcagcttccc
gtcaacaatggcccgaatgcgctgcatggcggcctcgacgggttcgaccgcaagctctgg
gcgatcgccgggatcgaagagggcgccgagcccgcggtgacgctcacctatacgagcccg
cacggcgaggagaattatccgggccggctcgatgtgcgcctgacctatcgcgtcaccggc
cccgccgagctgtcgctgatgatggaggcgcggacggaccggccgaccatcgtcaatttg
accaaccacagcttcttcaatctcgaaggcgcgacatcaggcacgtccattctcgaccac
agactgacggtcgcagccgagcatttcctcgcgatcgatcccaccgccattccgctgccg
gagccgccgcgcgcggtggccggcacgccgttcgacttccgcaacccgcatgccgtaggc
gagcgcatccgcgaaaacgatcggcaattgcagagcggcaggggttacgaccacacctac
tgcctcggccgcgacggcaagctcgcgctcgcggcacggctggaagccccgcgttcagga
cgcatcatggagctgttcaccaatcagcccggcatccaggtctattccggcaactatctc
gacggcacgatctcgggcaagggcggcaagctgatccgacaatcggacgccatgtgtctc
gagccgcacatctggcccgacgcgccgaaccggccggactttccgagtccgcgcctcgat
cccggccaagtctaccggcatcacaccgtctatcgctttgcagtgagggcgccatga

DBGET integrated database retrieval system