KEGG   Bradyrhizobium diazoefficiens USDA 110: blr3367Help
Entry
blr3367           CDS       T00109                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    blr3367
Enzymes [BR:bja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     blr3367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3731701..3732777
Genome map
AA seq 358 aa AA seqDB search
MQACAADRSLVSTNGSKMRAIRARWTRSFNLAATAVFLASFGFHANGAGQAASRDLPKLG
RGINILGYDGIWEGGRNAPFRLDNLTAIRKAGFSHVRINFFGFKFMGPGNVLDEIVLRRL
DAVIEDVLARNLIPIVDEHDTHICQRDVSECGEKLRAFWRQIAERYAGKYPALVFEVLNE
PGGQMTSGDWNSLLNECLEIIRRTNPARPVIAAVLNTDDIPVDDLALPADDRNLIVTFHY
YAPIRFTHQGAPWSPTFSRIGPLDWGSPDDEAKAAADFEKMNLWAEKEKRPVYLGEFGVY
ERAPSDSRARYLSFMARSADRLGWSWAYWQFDHDFAAFDSARQAWKPDILRALIPPQR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggcctgtgccgcagaccgatctctagtctcaacgaatggaagcaagatgagagcc
atccgcgctcgctggacgagaagcttcaatcttgcggcaacggcagttttcctcgcgtcg
tttggcttccatgccaatggggccgggcaggctgcttcccgtgacctgccgaaattgggg
cgcggcatcaatattctcggctatgacgggatctgggaaggcggccggaacgcgccattc
cgcctggacaatctgacggcaatcaggaaggccggattttcgcacgtcaggatcaacttt
ttcggcttcaagttcatgggcccggggaacgtgctggacgagatcgttctgaggcggctc
gatgccgtcatcgaggacgtccttgcaagaaacctcattccgatcgttgacgagcacgac
acccatatctgccaacgcgacgtttccgaatgcggcgagaagctcagggcattctggcgg
cagatcgccgagcgctatgccggaaaatatcccgcgctggtcttcgaggtcctgaacgag
cctggcgggcaaatgacgtccggcgactggaattcgctcctcaacgaatgtcttgaaatc
atccgccgcaccaatccggcgcggccggtcattgccgcggttctcaatacggacgacatc
cccgtcgacgacctggctctgccggccgacgacaggaacctgattgtcacgtttcactat
tacgcgccgatacgattcacgcatcagggcgcaccgtggtccccgacgttttcgcggatc
gggccgctggattggggcagtcccgacgacgaagccaaggctgctgctgacttcgagaag
atgaatctctgggcggagaaggagaagcgccccgtctatctcggcgagttcggggtatac
gagcgtgcgccatccgacagccgcgcaagatatctgtcgttcatggcgagaagcgccgac
aggcttggctggtcatgggcctattggcaattcgaccatgatttcgcggccttcgacagc
gcgcgtcaggcctggaagccggacatcctgcgtgcgctgattccgccgcagcgttga

DBGET integrated database retrieval system