KEGG   Bradyrhizobium diazoefficiens USDA 110: blr3958Help
Entry
blr3958           CDS       T00109                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00010  Glycolysis / Gluconeogenesis
bja00620  Pyruvate metabolism
bja00640  Propanoate metabolism
bja00680  Methane metabolism
bja01100  Metabolic pathways
bja01110  Biosynthesis of secondary metabolites
bja01120  Microbial metabolism in diverse environments
bja01130  Biosynthesis of antibiotics
bja01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    blr3958
   00620 Pyruvate metabolism
    blr3958
   00640 Propanoate metabolism
    blr3958
  Energy metabolism
   00680 Methane metabolism
    blr3958
Enzymes [BR:bja01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     blr3958
Lipid biosynthesis proteins [BR:bja01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   blr3958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 1053960
NCBI-ProteinID: NP_770598
RhizoBase: blr3958
UniProt: Q89N84
Position
4392448..4394166
Genome map
AA seq 572 aa AA seqDB search
MTTFQEARAFLLQHRTDYEAAVKGFRWPDPTPFNWALDWFDAELAANAESKDRPALWIVD
AAQDRQTKLSFAALSRRSNQVANFLRAQGLRRGDHLLLLLGNVVPLWETMLAAIKLGVVV
IPATTLLTADELRDRLDRGKAKAVVAAQDQVAKFASLGAENVVRIVVGAASDGWLAYDEA
AEAPDSFVPDGPTHADDPMLLYFTSGTTAKPKLVLHSQRSYPVGHLSTMYWIGLKPGDVH
LNISSPGWAKHAWSCFFAPWNAGATVFVVNQPRFDAKALLATIGRCGVTTLCAPPTVWRL
FIQENLASFKVALREVCGAGEPLNPEVIDQVQAAWGLTIRDGYGQTETTALAGNSPGQNI
KVGSMGRPLPGYRVQVSDADGNPAKEGEVTLVLGANRPAGLMQGYQGDDGKLSGAEGALY
RSGDVVFEDEDGYLTFVGRSDDVFKSSDYRISPFELESVLLEHELVAEAAVVPSPDPIRL
AIPKAFVLLTSGSERTPETALSIFKHLHTRLAPFKRIRRLEIVTELPKTISGKIRRVQLR
RLERDDDRGDPLRGREFREEDFPELPKTRSES
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatttcaggaagcgcgcgcgtttcttctacaacaccgcacggattacgaggcg
gcggtcaaaggcttccgctggcccgatccgacccccttcaactgggcgctcgactggttc
gacgccgagctggcggcgaatgcggagagcaaggatcgccccgcgctctggatcgtcgat
gccgcacaggaccggcagacgaaattgtccttcgcggcgctgtcgcgccgttccaaccag
gtcgccaacttcctccgagcgcagggcctgaggcgtggcgaccatctcctgctgctgctc
ggcaatgtggttccgctgtgggagaccatgctcgctgcgataaagctcggtgtcgtcgtc
atccccgccaccacgctgctcaccgccgacgagctgcgcgaccggctcgatcgcggcaag
gcgaaggccgtggtggccgcgcaggatcaggtcgcgaagttcgcgagcctcggtgcagag
aatgtcgtccgcatcgtggtcggcgcggcctccgatggctggctcgcttacgatgaggcg
gcagaggctccggatagcttcgtgcccgacggccccacccacgccgacgacccgatgctg
ctctatttcacctcgggcaccacggcaaagccgaagctggtgctgcatagccagcgcagc
tatcccgtcggccatctctccaccatgtactggatcgggctgaagcccggcgacgtccat
ctcaacatctcttcgcccggctgggccaagcacgcctggagctgcttcttcgcgccgtgg
aacgcgggcgccaccgtgttcgtggtgaaccagccgcgcttcgatgcgaaggcgctgctc
gccaccatcggccgctgcggtgtcaccacgctatgcgcgccgccgaccgtgtggcggctg
ttcatccaggagaaccttgcctcgttcaaggtcgcgttgcgcgaggtctgcggcgccggc
gagccgctcaatcccgaggtgatcgaccaggtgcaggcggcctggggccttaccatccgc
gacggctacggccagaccgagaccaccgcgcttgccggcaactcgccggggcaaaacatc
aaggtcggctcgatgggccgcccgctgccgggctatcgcgtgcaggtcagcgatgccgac
ggcaacccggcgaaggaaggcgaggtgacgctggtgctcggggcgaaccgtcccgccggc
ctgatgcagggctatcagggcgacgacggcaagctctcgggtgccgagggcgcactctat
cgcagcggcgacgtcgtgttcgaagacgaagatggttatctcaccttcgtcggccgctcc
gacgacgtgttcaaatcgtccgattaccgcatcagtccgttcgagctggaaagcgtgttg
ctcgagcatgaactcgtcgccgaggctgccgtggtgccgagcccggatccgatccggctg
gcaatccccaaagcgttcgtgctgctgacttcggggtcggagcgaacaccggagacggcg
ctttcgatcttcaagcacctgcacacccgccttgcgccgttcaagcgcatccgccgcctt
gaaatcgtcaccgagctgccgaagacgatctctggcaaaatccgccgcgtgcagctacga
cgtctcgagcgcgacgatgatcggggcgatccgctgcgtggccgggaattccgcgaggag
gattttccggagctgccgaaaacccggagcgagagttaa

DBGET integrated database retrieval system