KEGG   Bradyrhizobium japonicum USDA110: blr4109Help
Entry
blr4109           CDS       T00109                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bja00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bja00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:bja03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:bja03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bja03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4542332..4542784
Genome map
AA seq 150 aa AA seqDB search
MTEVLFYHLQNMTVENVLPPLLEKSLERGWRVVVQSTSEERADALDAHLWTYRDDSFLPH
ATWRVNDAADQPIVLAIEEDNPNGAHVRFLVDNAALPQDAQGYERMVLLFNGDDPDALAL
ARSAWTDCKARGFDVTYWQADERGRWQRRN
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtgctgttctaccatctgcaaaacatgacggtggagaacgtgttgccgccg
cttctcgagaaatcgctcgagcgcggctggcgcgtcgtggtgcagtcgacctcggaggaa
cgcgccgatgcgctcgatgcgcatctgtggacctatcgcgacgattccttcctgccgcac
gcgacatggcgcgtgaacgatgccgccgatcagccgatcgtgctggcgatcgaggaggac
aatcccaacggcgcccatgtccgctttctggtcgacaacgcagcgctgccgcaggatgcg
cagggctatgagcgcatggtgctgctgttcaacggcgacgatccggacgcgctggcgctc
gcccgcagtgcctggacggattgcaaggcgcggggatttgatgtcacctattggcaggcc
gacgaacggggtcggtggcagcggcggaattag

DBGET integrated database retrieval system