KEGG   Bradyrhizobium diazoefficiens USDA 110: blr4472Help
Entry
blr4472           CDS       T00109                                 

Gene name
pcm
Definition
(RefSeq) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
Enzymes [BR:bja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     blr4472 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 Methyltransf_12 MTS Methyltransf_11 RrnaAD Methyltransf_23 PrmA Eno-Rase_NADH_b
Motif
Other DBs
NCBI-GeneID: 1052682
NCBI-ProteinID: NP_771112
RhizoBase: blr4472
UniProt: Q89LS1
Position
4950693..4951415
Genome map
AA seq 240 aa AA seqDB search
MFQRCRQLSSAASSAFQGPQMSGFSTARLKMVDGQVRTNDVTDRRVLDAMLTVPREAFVP
ASRQALAYLDLDLDVSEGGGKRFLIKPQLTGKLLQAAEIGEGDNVLVVGCATGYLAALAA
KLAGRVTATECDSALVAKAKDAFAALGLANVTCKAASCTEGDPSAAPYDVIILNGAVEVT
PEGLLGQLGEGGRLVGVSAESRPPRAVIVTHTHGEFGHRALFDAAAPVLPGLERAAAFVF
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgttccaaagatgccggcaactttcgtccgcggcatcgtccgcatttcagggtccgcaa
atgtccggtttctcgaccgcgcgcctcaaaatggtcgatggccaggtgcgcaccaacgac
gtcactgatcgccgtgtcctcgacgccatgctcacggttccgcgcgaggccttcgtgccg
gcgagccgccaggccttggcctatctcgacctcgacctcgatgtgagcgagggcggcggc
aagcggttcctgatcaagccgcagctgaccggtaagctgctccaggccgccgagatcggc
gagggtgacaacgtgctggtggtcggctgcgccacgggctacctcgcggcattggccgcc
aagctggcgggtcgggttaccgcgacggaatgcgattcggccctggttgcgaaagccaag
gacgccttcgccgccctcgggctcgccaatgtcacttgcaaggccgcttcctgcaccgag
ggtgacccctctgccgcaccgtatgatgtcattatcctcaatggcgctgtcgaggtgacg
ccggaagggctgctcgggcagcttggggaaggcgggcgtctggtgggggtatctgccgaa
tcccggccgccgcgggccgtgatcgtgacccatacccacggcgaattcggccatcgggcg
ctgttcgatgccgccgccccggtcctcccagggctggaacgggccgccgccttcgtcttc
tga

DBGET integrated database retrieval system