KEGG   Bradyrhizobium diazoefficiens USDA 110: blr4550Help
Entry
blr4550           CDS       T00109                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    blr4550
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    blr4550
   00052 Galactose metabolism
    blr4550
   00500 Starch and sucrose metabolism
    blr4550
   00520 Amino sugar and nucleotide sugar metabolism
    blr4550
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    blr4550
   00524 Butirosin and neomycin biosynthesis
    blr4550
Enzymes [BR:bja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     blr4550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
5043445..5044431
Genome map
AA seq 328 aa AA seqDB search
MSIGKTGKILLADIGGTNARFALSQSEPGNGDQTGSIDYVKVADFPTVQEAIVDVLARRA
GGEPPQRAVLAVAGPVTNNRCVMTNSPWVIDGNELQPTLGFDSVHVLNDFEVVAWSLPAL
RSADLIPLGGQDGLPGEPLLVVGPGTGFGVSCLVERYGARLAVVTEAGHATLPAENEREE
RVIASLRRRFGHVSIERGALSGSGLQSLYEALAEIDGVQVPHRDAAAITKAALDGSCPVS
RATLEMFCATLGSVAGNLAVTFGARGGVYIAGGIVPRFPEFLAASAFRARFEAKGRFQDY
LRNIPTRLVTKPDASFVGLKMFADHNPD
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcggcaagacaggaaaaattcttctcgccgatatcggcggcaccaatgcgcgc
tttgcgctgagccaaagcgaaccgggcaacggcgaccagaccggatcgatcgactatgtg
aaggtcgccgacttcccgaccgtccaggaagccattgtcgacgtgctggcgcgccgggcc
ggcggcgaaccgccccaacgagccgtgctggccgtcgcaggccccgtcaccaacaaccgc
tgcgtcatgaccaacagcccctgggtcatcgacggcaacgagctccagccaacgctcggc
ttcgacagcgtccatgtgctcaacgatttcgaggtggtcgcctggtccctgcccgccttg
cggtccgccgatctgatcccgctcggcggacaagatggcctccccggagaaccgttgctg
gtggtcgggcccggaaccggctttggcgtctcctgtctggttgagcgctatggggcgcgg
ctggccgtcgtcaccgaggctggccacgcgacgttgccggcagagaacgagcgcgaggaa
cgcgtgatcgcgtccttgcgccgacgtttcggccatgtctccatcgagcgcggcgcgctg
tcgggctccggcttgcaaagcctctacgaggcactcgcggagatcgacggcgtccaggtg
ccgcaccgcgacgcggccgccatcaccaaggcggccctggatggcagctgcccggtcagc
cgcgcgacgctggagatgttctgcgccaccctgggctcggtcgcgggcaacctcgcggtg
accttcggtgcccgcggcggcgtctatatcgccggcgggatcgtgccgcgcttcccggag
ttccttgcggcctccgcgttccgcgcgcgcttcgaagccaaggggcgcttccaggactat
ttgcgcaacatcccgacccggctcgtcacgaagcccgatgccagcttcgtcgggctgaag
atgttcgccgaccacaatcctgattga

DBGET integrated database retrieval system