KEGG   Bradyrhizobium japonicum USDA110: blr4659Help
Entry
blr4659           CDS       T00109                                 

Definition
PfkB family carbohydrate kinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:bja01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bja01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bja00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bja00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bja00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bja00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:bja00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
5159288..5160175
Genome map
AA seq 295 aa AA seqDB search
MVPYTKMRCAAPQRDPGGGGINVARVLKRLGFEATAVYPAGGATGQTLTALVEREAVRSI
VIPISNDTREDITIFDETSKEQFRLVFPGACLNEFEWQQCLDAIARLSPQAAFVIASGSL
PPGAPADFYGRVVRASTGAAKVVVDTSGASLKAALEAGVYLIKPNLREFQELAGISGADE
SSLLEAGRRLIDRYRIEIIALSMGPGGALLLTRDIALRANGLPLEPVSVSGAGDSFLGAM
VSRLANGDKLDSALRYGVAGGSAALLSPGTGLCLGADVHRLASNVNVTIIAGYHA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggtgccctacacgaaaatgcgctgcgccgcgcctcagcgcgatcccggcggtggcgga
atcaatgtggcccgtgtcctgaaacggctgggctttgaggcgaccgcagtctatccagcc
ggcggcgcaaccgggcaaaccctgacggcgctggttgaacgtgaggccgtgcgcagcatc
gtcatcccgatatcgaacgatacccgcgaagacatcaccatcttcgacgagacgagcaag
gagcagttccggctggtatttccgggcgcctgcctcaacgaattcgaatggcagcagtgt
ctcgacgcaattgcgcgtctcagtccgcaggctgcctttgtcatcgcaagcggcagcctg
ccgccgggagccccggccgatttctacggcagggtggtcagggcatcgacgggagcggcc
aaggtcgtcgttgatacgtccggcgcctcgctcaaagccgcgctggaagcgggcgtctat
ctcatcaagcccaaccttcgggagtttcaggagctggccgggatcagtggcgccgacgag
tcctcgctcctggaggcggggcgccgcctgatcgatcgttatcgcatcgagatcattgct
ctctcgatgggccccggcggggccctgctcctgacgcgcgacatcgccttgcgtgcgaat
ggccttcctttggagcctgtcagcgtttccggcgcaggcgacagcttcctgggggcgatg
gtgtcgcgcctcgccaatggcgacaagctcgatagcgccctgcgttatggtgttgccggc
ggttcggcggcgctgctcagtcccggaacggggctttgcctcggtgcggacgttcatcgc
ctcgcatccaacgtgaacgtcacaatcatagccggctatcatgcttag

DBGET integrated database retrieval system