KEGG   Bradyrhizobium diazoefficiens USDA 110: blr4659Help
Entry
blr4659           CDS       T00109                                 

Definition
PfkB family carbohydrate kinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    blr4659
   01230 Biosynthesis of amino acids
    blr4659
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    blr4659
   00030 Pentose phosphate pathway
    blr4659
   00051 Fructose and mannose metabolism
    blr4659
   00052 Galactose metabolism
    blr4659
  Energy metabolism
   00680 Methane metabolism
    blr4659
Enzymes [BR:bja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     blr4659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
5159288..5160175
Genome map
AA seq 295 aa AA seqDB search
MVPYTKMRCAAPQRDPGGGGINVARVLKRLGFEATAVYPAGGATGQTLTALVEREAVRSI
VIPISNDTREDITIFDETSKEQFRLVFPGACLNEFEWQQCLDAIARLSPQAAFVIASGSL
PPGAPADFYGRVVRASTGAAKVVVDTSGASLKAALEAGVYLIKPNLREFQELAGISGADE
SSLLEAGRRLIDRYRIEIIALSMGPGGALLLTRDIALRANGLPLEPVSVSGAGDSFLGAM
VSRLANGDKLDSALRYGVAGGSAALLSPGTGLCLGADVHRLASNVNVTIIAGYHA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggtgccctacacgaaaatgcgctgcgccgcgcctcagcgcgatcccggcggtggcgga
atcaatgtggcccgtgtcctgaaacggctgggctttgaggcgaccgcagtctatccagcc
ggcggcgcaaccgggcaaaccctgacggcgctggttgaacgtgaggccgtgcgcagcatc
gtcatcccgatatcgaacgatacccgcgaagacatcaccatcttcgacgagacgagcaag
gagcagttccggctggtatttccgggcgcctgcctcaacgaattcgaatggcagcagtgt
ctcgacgcaattgcgcgtctcagtccgcaggctgcctttgtcatcgcaagcggcagcctg
ccgccgggagccccggccgatttctacggcagggtggtcagggcatcgacgggagcggcc
aaggtcgtcgttgatacgtccggcgcctcgctcaaagccgcgctggaagcgggcgtctat
ctcatcaagcccaaccttcgggagtttcaggagctggccgggatcagtggcgccgacgag
tcctcgctcctggaggcggggcgccgcctgatcgatcgttatcgcatcgagatcattgct
ctctcgatgggccccggcggggccctgctcctgacgcgcgacatcgccttgcgtgcgaat
ggccttcctttggagcctgtcagcgtttccggcgcaggcgacagcttcctgggggcgatg
gtgtcgcgcctcgccaatggcgacaagctcgatagcgccctgcgttatggtgttgccggc
ggttcggcggcgctgctcagtcccggaacggggctttgcctcggtgcggacgttcatcgc
ctcgcatccaacgtgaacgtcacaatcatagccggctatcatgcttag

DBGET integrated database retrieval system