KEGG   Bradyrhizobium diazoefficiens USDA 110: blr4810Help
Entry
blr4810           CDS       T00109                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bja01100  Metabolic pathways
bja01110  Biosynthesis of secondary metabolites
bja01130  Biosynthesis of antibiotics
bja01230  Biosynthesis of amino acids
Module
bja_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    blr4810 (trpC)
Enzymes [BR:bja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     blr4810 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-GeneID: 1052206
NCBI-ProteinID: NP_771450
RhizoBase: blr4810
UniProt: P94327
Position
5330289..5331110
Genome map
AA seq 273 aa AA seqDB search
MSDILTKIETYKREEIAAAKRAQPLSVVEATAKAQGAPRGFLRAIKAKHTNGDFALIAEV
KKASPSKGLIRADFDPPQLAKAYEAGGAACLSVLTDTPSFQGHLDFMVAARAATSLPVLR
KDFMFDAYQVVEARAHGADCILIIMAALDDATAKDLEDTAIAFGMDVLIEIHDRAELDRA
LKLRSPMIGVNNRNLRTFETTLATSEALAPLIPGDRLMVGESGIFTPADLARLERVGMST
FLVGESLMRQADVTAATRTLLARETTARATGTR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacatcctgaccaagatcgagacgtacaagcgcgaagagatcgccgccgccaag
cgcgcgcagccgctctccgtcgtcgaagcaacggccaaggcgcaaggagcaccgcgcggc
ttcctgcgcgccatcaaggccaagcacaccaatggcgacttcgcgctgatcgccgaggtc
aagaaggcctcgccgtcgaaggggctgatccgcgccgatttcgatccgccacagctcgcc
aaggcctatgaggcgggcggcgccgcctgcctttcggtgctgacggacacgccgtcgttc
cagggccatctcgacttcatggtggccgcgcgtgcggcgacgtcactgccggtgctgcgc
aaggacttcatgttcgacgcctatcaggtggtcgaagcccgcgcgcatggcgccgactgc
atcctgatcatcatggccgcgctcgacgacgccaccgccaaggacctggaagacacagct
atcgcctttggcatggatgtgctgatcgagatccatgaccgcgccgagctcgaccgcgcg
ctcaagctgcgctcgccgatgatcggcgtcaacaaccgcaacctgcgcaccttcgagacc
acgctcgcgaccagcgaagcgttggcgccgctgatccccggggaccggctgatggtcggc
gagagcggcatcttcacgcccgcagacctcgcccggctcgagcgcgtcggcatgtcgacc
ttcctggtcggcgagagcctgatgcggcaggccgacgtgaccgccgccacgcgtacgctg
ctcgcgcgcgagacgacagcccgcgcgaccggtacgcgctga

DBGET integrated database retrieval system