KEGG   Bradyrhizobium japonicum USDA110: blr4874Help
Entry
blr4874           CDS       T00109                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:bja01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bja00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bja00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bja00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:bja00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:bja00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
5403905..5404993
Genome map
AA seq 362 aa AA seqDB search
MNIMKAAVLKSFGTPLVIENAPEPVLGTGEVIVDVVTTRVLSYMNEVFSGERNYALDLPI
IPGPGGIGRVRAIGPDATKLKIGDWVFCDPTVRSRDDAIAPDIALQGLTAAGAGGMLLQK
HFRHGSFAEQMRVPTENVKRLGAITSEEAAQWCALGTLLVPYGGLLAANLQAGETVLVSG
ATGNFGSAAVSVALAMGAACVVTPGRNETILADLVRRFGSRVKPVKLTGNEDDDREAMKR
AAPGPIDCVFDIMPPSVSPTVVRAAVMTVRAYGRVVLMGGVGMAGGAGLELPYPWIMRNC
ITIHGVWMYPPDAASRLIALVRSGLLRLDEYKTTAFDLDHVNEAVAHAAANGGPFRLTVI
RP
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatcatgaaagccgccgtactcaaatccttcggaacgccgctggtgatcgagaat
gcccccgaaccggtgctcggcaccggcgaggtcatcgtcgacgtcgtcaccacgcgcgtg
ctgtcctacatgaacgaagtcttcagcggcgaacgcaactatgcactcgatttgccgatc
atcccgggcccgggcggcatcggccgggtgcgcgcgatcggcccggacgcaacgaagctc
aagatcggcgactgggtgttctgcgacccgacggtgcgttcgcgcgacgacgcgatcgcg
cccgacatcgccctgcagggattaacggccgccggcgccggcggcatgcttctgcaaaag
cattttcgccatggctcgtttgccgagcaaatgcgggtgccgaccgagaacgtcaaacgc
cttggcgcgatcacgtccgaggaagccgcacaatggtgcgcgctggggacactgctggtg
ccctatggcggcctcctcgccgccaacctgcaagcaggcgaaaccgtgctggtgagtggc
gccaccggcaatttcggcagcgccgccgtctctgtcgcgctcgcgatgggcgcagcctgc
gtggtcacgcccgggcgcaacgagacgattctggccgacctcgtccgccgtttcggcagc
cgtgtgaagccggtcaagctcacaggtaacgaggacgacgaccgcgaggcgatgaagcgc
gccgcgccggggccgatcgactgcgtgttcgacatcatgccgccctcggtgagtccgact
gtggtgcgcgcggcggtcatgacggtgcgcgcctatggccgcgtcgtgctgatgggcggc
gtcggcatggccggcggcgcgggcctcgagctgccctacccctggatcatgcgcaactgc
atcaccatccacggcgtctggatgtacccgccggatgcggccagccgcctgatcgcgctg
gtgcgatcaggactcctgcggcttgacgagtacaagacgacggcgttcgacctcgatcac
gtcaatgaggcggtggcacacgccgcggccaatggcgggccgttcagattgacggtgatc
cggccgtag

DBGET integrated database retrieval system