KEGG   Bradyrhizobium diazoefficiens USDA 110: blr4874Help
Entry
blr4874           CDS       T00109                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00010  Glycolysis / Gluconeogenesis
bja00071  Fatty acid degradation
bja00350  Tyrosine metabolism
bja00625  Chloroalkane and chloroalkene degradation
bja00626  Naphthalene degradation
bja01100  Metabolic pathways
bja01110  Biosynthesis of secondary metabolites
bja01120  Microbial metabolism in diverse environments
bja01130  Biosynthesis of antibiotics
bja01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    blr4874
  Lipid metabolism
   00071 Fatty acid degradation
    blr4874
  Amino acid metabolism
   00350 Tyrosine metabolism
    blr4874
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    blr4874
   00626 Naphthalene degradation
    blr4874
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     blr4874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N PALP ADH_zinc_N_2 CoA_binding_2 Sacchrp_dh_NADP Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 1052090
NCBI-ProteinID: NP_771514
RhizoBase: blr4874
UniProt: Q89KN1
Position
5403905..5404993
Genome map
AA seq 362 aa AA seqDB search
MNIMKAAVLKSFGTPLVIENAPEPVLGTGEVIVDVVTTRVLSYMNEVFSGERNYALDLPI
IPGPGGIGRVRAIGPDATKLKIGDWVFCDPTVRSRDDAIAPDIALQGLTAAGAGGMLLQK
HFRHGSFAEQMRVPTENVKRLGAITSEEAAQWCALGTLLVPYGGLLAANLQAGETVLVSG
ATGNFGSAAVSVALAMGAACVVTPGRNETILADLVRRFGSRVKPVKLTGNEDDDREAMKR
AAPGPIDCVFDIMPPSVSPTVVRAAVMTVRAYGRVVLMGGVGMAGGAGLELPYPWIMRNC
ITIHGVWMYPPDAASRLIALVRSGLLRLDEYKTTAFDLDHVNEAVAHAAANGGPFRLTVI
RP
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatcatgaaagccgccgtactcaaatccttcggaacgccgctggtgatcgagaat
gcccccgaaccggtgctcggcaccggcgaggtcatcgtcgacgtcgtcaccacgcgcgtg
ctgtcctacatgaacgaagtcttcagcggcgaacgcaactatgcactcgatttgccgatc
atcccgggcccgggcggcatcggccgggtgcgcgcgatcggcccggacgcaacgaagctc
aagatcggcgactgggtgttctgcgacccgacggtgcgttcgcgcgacgacgcgatcgcg
cccgacatcgccctgcagggattaacggccgccggcgccggcggcatgcttctgcaaaag
cattttcgccatggctcgtttgccgagcaaatgcgggtgccgaccgagaacgtcaaacgc
cttggcgcgatcacgtccgaggaagccgcacaatggtgcgcgctggggacactgctggtg
ccctatggcggcctcctcgccgccaacctgcaagcaggcgaaaccgtgctggtgagtggc
gccaccggcaatttcggcagcgccgccgtctctgtcgcgctcgcgatgggcgcagcctgc
gtggtcacgcccgggcgcaacgagacgattctggccgacctcgtccgccgtttcggcagc
cgtgtgaagccggtcaagctcacaggtaacgaggacgacgaccgcgaggcgatgaagcgc
gccgcgccggggccgatcgactgcgtgttcgacatcatgccgccctcggtgagtccgact
gtggtgcgcgcggcggtcatgacggtgcgcgcctatggccgcgtcgtgctgatgggcggc
gtcggcatggccggcggcgcgggcctcgagctgccctacccctggatcatgcgcaactgc
atcaccatccacggcgtctggatgtacccgccggatgcggccagccgcctgatcgcgctg
gtgcgatcaggactcctgcggcttgacgagtacaagacgacggcgttcgacctcgatcac
gtcaatgaggcggtggcacacgccgcggccaatggcgggccgttcagattgacggtgatc
cggccgtag

DBGET integrated database retrieval system